Protein A ELISA Kit 60810

$570.00

Summary

ELISA kit for research use (RUO)
Reactivity: Protein A
Suitable for: ELISA
Time:3 hours
Sample types: Serum, plasma, tissue homogenates and other biological fluids

SKU: 60810 Category: sELISA Tags: HCP, Protein A, sandwich (sELISA)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
target	Protein A
species reactivity	Staphylococcus
applications	sandwich (sELISA)
assay type	direct & quantitative
available size	96 tests
sensitivity	46.875 pg/ml
range	78.125–5000 pg/ml

Protein A ELISA Kit

Assay type
sandwich (sELISA)

Research area
host cell protein

Sample type
Serum, plasma, tissue homogenates and other biological fluids

Components

Break apart microtiter test strips each coated single wells	8 x 12 (96 Total)
Lyophilized Standard	2 x vial
HRP Antibody(Concentrated, 100X)	120 uL
Washing solution concentrate (25X)	30 mL
Sample Dilution buffer	20 mL
Antibody Dilution buffer	10 mL
Stopping solution	10 mL
TMB Substrate (ready-to-use)	10 mL
Plate seals	3

Storage
Store at 2-8°C.

target relevance
Staphylococcus aureus SPA Immunoglobulin G-binding protein A
Protein names Immunoglobulin G-binding protein A
Alternative names Staphylococcal protein A
Gene names spa
Protein family Belongs to the immunoglobulin-binding protein SpA family
Function Plays a role in the inhibition of the host innate and adaptive immune responses. Possesses five immunoglobulin-binding domains that capture both the fragment crystallizable region (Fc region) and the Fab region (part of Ig that identifies antigen) of immunoglobulins (By similarity). In turn, Staphylococcus aureus is protected from phagocytic killing via inhibition of Ig Fc region. In addition, the host elicited B-cell response is prevented due to a decrease of antibody-secreting cell proliferation that enter the bone marrow, thereby decreasing long-term antibody production. Inhibits osteogenesis by preventing osteoblast proliferation and expression of alkaline phosphatase, type I collagen, osteopontin and osteocalcin. Acts directly as a pro-inflammatory factor in the lung through its ability to bind and activate tumor necrosis factor alpha receptor 1/TNFRSF1A (By similarity)
Subcellular location Secreted, cell wall
Structure Interacts with host TNFRSF1A; this interaction leads to the stimulation of both surface expression and shedding of TNFRSF1A. Interacts (via B domain) with IgG1, IgG2 and IgG4; spa interferes with IgG oligomerization and IgG:C1 complement complex formation, preventing complement activation and ultimately protecting bacteria from phagocytic killing
Keywords 3D-structure, Cell wall, Direct protein sequencing, IgG-binding protein, Peptidoglycan-anchor, Repeat, Secreted, Signal, Virulence
Sequence MKKKNIYSIRKLGVGIASVTLGTLLISGGVTPAANAAQHDEAQQNAFYQVLNMPNLNADQ RNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNKFNKDQQSAFYEILNMPNLNEE QRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQR NGFIQSLKDDPSQSANLLAEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNG FIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFI QSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDGNKPGKEDGNKPGKEDNKKPGK EDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPG DTVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEE NPFIGTTVFGGLSLALGAALLAGRRREL
UniProt accession: P38507

Data

Standard Curve

X axis: log | Y axis: linear

Standard	STD [pg/mL]	OD1	OD2	Average OD	Corrected OD
Blank #8	0	0.07	0.07	0.07	0
Standard #7	78.13	0.14	0.14	0.14	0.07
Standard #6	156.25	0.21	0.22	0.22	0.15
Standard #5	312.5	0.43	0.45	0.44	0.37
Standard #4	625	0.8	0.82	0.81	0.74
Standard #3	1250	1.08	1.12	1.1	1.03
Standard #2	2500	1.56	1.6	1.58	1.51
Standard #1	5000	2.24	2.3	2.27	2.2

Precision

Sample	n	Mean	Standard Deviation	CV (%)
Intra Sample 1	20	157.3	8.24	5.24
Inter Sample 1	20	151.4	8.1	5.35
Intra Sample 2	20	625.8	32.48	5.19
Inter Sample 2	20	647.8	34.27	5.29
Intra Sample 3	20	2585	132.61	5.13
Inter Sample 3	20	2563	134.04	5.23

Stability

37°C 1 Month (%)	2–8°C 6 Months (%)	2–8°C 12 Months (%)
80	95-100	85-98

FAQ & Publications

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.