Bovine Serum Albumin (BSA) ELISA Kit 60800

$570.00

Summary

ELISA kit for research use (RUO)
Reactivity: Bovine serum albumin
Suitable for: ELISA
Time:3 hours
Sample types: Serum, plasma, tissue homogenates and other biological fluids

SKU: 60800 Category: cELISA Tags: Bovine Serum Albumin (BSA), HCP, sandwich (sELISA)

Weight	1 lbs
Dimensions	9 × 5 × 2 in
target	Bovine Serum Albumin (BSA)
species reactivity	bovine
applications	competition (cELISA)
assay type	direct & quantitative
available size	96 tests
sensitivity	0.094 µg/ml
range	0.156–10 µg/ml

Bovine Serum Albumin (BSA) ELISA Kit

Assay type
competition (cELISA)

Research area
host cell protein

Sample type
Serum, plasma, tissue homogenates and other biological fluids

Components

Break apart microtiter test strips each coated single wells	8 x 12 (96 Total)
Lyophilized Standard	2 x vial
HRP Antibody(Concentrated, 100X)	120 uL
Washing solution concentrate (25X)	30 mL
Sample Dilution buffer	20 mL
Antibody Dilution buffer	10 mL
Stopping solution	10 mL
TMB Substrate (ready-to-use)	10 mL
Plate seals	3

Storage
Store at 2-8°C.

target relevance
Bos taurus ALB Albumin
Protein names Albumin
Alternative names BSA
Gene names ALB
Protein family Belongs to the ALB/AFP/VDB family
Function Binds water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloidal osmotic pressure of blood. Major zinc transporter in plasma, typically binds about 80% of all plasma zinc (By similarity). Major calcium and magnesium transporter in plasma, binds approximately 45% of circulating calcium and magnesium in plasma (Probable). Potentially has more than two calcium-binding sites and might additionally bind calcium in a non-specific manner (PubMed:22677715). The shared binding site between zinc and calcium at residue Asp-272 suggests a crosstalk between zinc and calcium transport in the blood (Probable). The rank order of affinity is zinc > calcium > magnesium (Probable). Binds to the bacterial siderophore enterobactin and inhibits enterobactin-mediated iron uptake of E.coli, and may thereby limit the utilization of iron and growth of enteric bacteria such as E.coli (PubMed:6234017). Does not prevent iron uptake by the bacterial siderophore aerobactin (PubMed:6234017)
Subcellular location Secreted
Structure Interacts with FCGRT; this interaction regulates ALB homeostasis (By similarity). Interacts with TASOR (By similarity). In plasma, occurs in a covalently-linked complex with chromophore-bound alpha-1-microglobulin; this interaction does not prevent fatty acid binding to ALB
Post-translational modification Phosphorylated by FAM20C in the extracellular medium
Keywords 3D-structure, Allergen, Calcium, Cleavage on pair of basic residues, Copper, Direct protein sequencing, Disulfide bond, Glycation, Glycoprotein, Lipid-binding, Metal-binding, Methylation, Phosphoprotein, Reference proteome, Repeat, Secreted, Signal, Zinc
Sequence MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPF DEHVKLVNELTEFAKTCVADESHAGCEKSLHTLFGDELCKVASLRETYGDMADCCEKQEP ERNECFLSHKDDSPDLPKLKPDPNTLCDEFKADEKKFWGKYLYEIARRHPYFYAPELLYY ANKYNGVFQECCQAEDKGACLLPKIETMREKVLASSARQRLRCASIQKFGERALKAWSVA RLSQKFPKAEFVEVTKLVTDLTKVHKECCHGDLLECADDRADLAKYICDNQDTISSKLKE CCDKPLLEKSHCIAEVEKDAIPENLPPLTADFAEDKDVCKNYQEAKDAFLGSFLYEYSRR HPEYAVSVLLRLAKEYEATLEECCAKDDPHACYSTVFDKLKHLVDEPQNLIKQNCDQFEK LGEYGFQNALIVRYTRKVPQVSTPTLVEVSRSLGKVGTRCCTKPESERMPCTEDYLSLIL NRLCVLHEKTPVSEKVTKCCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLP DTEKQIKKQTALVELLKHKPKATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPKLVV STQTALA
UniProt accession: P02769

Data

Standard Curve

X axis: log | Y axis: linear

Standard	STD [ng/mL]	OD1	OD2	Average OD	Corrected OD
Blank #8	0	2.12	2.23	2.18	0
Standard #7	0.16	1.85	1.95	1.9	-0.27
Standard #6	0.31	1.54	1.62	1.58	-0.6
Standard #5	0.63	1.17	1.23	1.2	-0.97
Standard #4	1.25	0.83	0.87	0.85	-1.33
Standard #3	2.5	0.65	0.69	0.67	-1.51
Standard #2	5	0.4	0.42	0.41	-1.76
Standard #1	10	0.26	0.27	0.27	-1.91

Precision

Sample	n	Mean	Standard Deviation	CV (%)
Intra Sample 1	20	0.33	0.02	6.3
Inter Sample 1	20	0.29	0.02	6.2
Intra Sample 2	20	1.27	0.07	5.86
Inter Sample 2	20	1.3	0.07	5.72
Intra Sample 3	20	5.16	0.26	4.95
Inter Sample 3	20	5.27	0.29	5.54

Recovery

Matrix	Recovery Range (%)	Average (%)
Serum(n=10)	85-103	96
EDTAPlasma(n=10)	85-102	95
Heparin Plasma(n=10)	85-101	93

Stability

37°C 1 Month (%)	2–8°C 6 Months (%)	2–8°C 12 Months (%)
80	95-100	85-98

Linearity

Sample	1:2 Dilution (%)	1:4 Dilution (%)	1:8 Dilution (%)
Serum(n=10)	92-100%	88-104%	89-105%
EDTAPlasma(n=10)	86-99%	82-90%	87-100%
HeparinPlasma(n=10)	84-100%	87-101%	80-104%

FAQ & Publications

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.