Skip to content

rabbit anti-ZIP Kinase polyclonal antibody 2387

$445.00

Antibody summary

  • Rabbit polyclonal to ZIP Kinase
  • Suitable for: ELISA,WB,ICC,IF
  • Isotype: IgG
  • 100 µg
SKU: 2387parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

ZIP Kinase

available sizes

100 µg

rabbit anti-ZIP Kinase polyclonal antibody 2387

antibody
Tested applications
WB,ICC/IF,ELISA
Recommended dilutions
Immunoblotting: use at 1ug/mL.

Positive control: HeLa cell lysate.

Immunocytochemistry: use at 10ug/mL.

These are recommended concentrations.

Enduser should determine optimal concentrations for their applications.
Immunogen
Peptide corresponding to aa 279- 298 of human ZIP kinase (accession no. BAA81746).
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
peptide affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens DAPK3
Death-associated protein kinase 3
Protein names
Death-associated protein kinase 3
Alternative names
DAP-like kinase, MYPT1 kinase, Zipper-interacting protein kinase
Gene names
DAPK3
Protein family
Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily
Function
Serine/threonine kinase which is involved in the regulation of apoptosis, autophagy, transcription, translation and actin cytoskeleton reorganization. Involved in the regulation of smooth muscle contraction. Regulates both type I (caspase-dependent) apoptotic and type II (caspase-independent) autophagic cell deaths signal, depending on the cellular setting. Involved in regulation of starvation-induced autophagy. Regulates myosin phosphorylation in both smooth muscle and non-muscle cells. In smooth muscle, regulates myosin either directly by phosphorylating MYL12B and MYL9 or through inhibition of smooth muscle myosin phosphatase (SMPP1M) via phosphorylation of PPP1R12A; the inhibition of SMPP1M functions to enhance muscle responsiveness to Ca(2+) and promote a contractile state. Phosphorylates MYL12B in non-muscle cells leading to reorganization of actin cytoskeleton. Isoform 2 can phosphorylate myosin, PPP1R12A and MYL12B. Overexpression leads to condensation of actin stress fibers into thick bundles. Involved in actin filament focal adhesion dynamics. The function in both reorganization of actin cytoskeleton and focal adhesion dissolution is modulated by RhoD. Positively regulates canonical Wnt/beta-catenin signaling through interaction with NLK and TCF7L2. Phosphorylates RPL13A on 'Ser-77' upon interferon-gamma activation which is causing RPL13A release from the ribosome, RPL13A association with the GAIT complex and its subsequent involvement in transcript-selective translation inhibition. Enhances transcription from AR-responsive promoters in a hormone- and kinase-dependent manner. Involved in regulation of cell cycle progression and cell proliferation. May be a tumor suppressor
Catalytic activity
L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+)
L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+)
Subcellular location
Nucleus, Cytoplasm
Structure
Homooligomer in its kinase-active form (homotrimers and homodimers are reported); monomeric in its kinase-inactive form. Homodimerization is required for activation segment autophosphorylation (Probable). Isoform 1 and isoform 2 interact with myosin and PPP1R12A; interaction of isoform 1 with PPP1R12A is inhibited by RhoA dominant negative form. Interacts with NLK, DAXX, STAT3, RHOD (GTP-bound form) and TCP10L. Interacts with PAWR; the interaction is reported conflictingly: according to PubMed:17953487 does not interact with PAWR. Interacts with ULK1; may be a substrate of ULK1. Interacts with LUZP1; the interaction is likely to occur throughout the cell cycle and reduces the LUZP1-mediated suppression of MYL9 phosphorylation (PubMed:38009294)
Post-translational modification
The phosphorylation status is critical for kinase activity, oligomerization and intracellular localization. Phosphorylation at Thr-180, Thr-225 and Thr-265 is essential for activity. The phosphorylated form is localized in the cytoplasm promoted by phosphorylation at Thr-299; nuclear translocation or retention is maximal when it is not phosphorylated. Phosphorylation increases the trimeric form, and its dephosphorylation favors a kinase-inactive monomeric form. Both isoform 1 and isoform 2 can undergo autophosphorylation
Keywords
3D-structure, Activator, Alternative splicing, Apoptosis, ATP-binding, Centromere, Chromatin regulator, Chromosome, Cytoplasm, Cytoskeleton, Kinase, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transcription, Transcription regulation, Transferase, Translation regulation, Tumor suppressor
Sequence
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
UniProt accession: O43293

Data

benchmark-antibodies_anti-zip_kinase_antibody_2387_1.gif
Western blot analysis of ZIP kinase in (A) HeLa and (B) Jurkat lysates with ZIP kinase antibody at 1 µg/mL.
benchmark-antibodies_anti-zip_kinase_antibody_2387_2.gif
Immunofluorescence of ZIPK in Jurkat cells with ZIPK antibody at 10 µg/mL.
benchmark-antibodies_anti-zip_kinase_antibody_2387_3.gif
Immunocytochemistry of ZIPK in Jurkat cells with ZIPK antibody at 10 µg/mL.

FAQ & Publications

Frequently Asked Questions
What are the recommended applications and dilutions for the rabbit anti-ZIP Kinase polyclonal antibody (SKU 2387)?
This antibody is suitable for ELISA, Western blot (WB), immunocytochemistry (ICC), and immunofluorescence (IF). Recommended dilutions are 1 µg/mL for immunoblotting using HeLa cell lysate as a positive control, and 10 µg/mL for immunocytochemistry. Users should optimize concentrations for their specific applications.
How should the rabbit anti-ZIP Kinase polyclonal antibody be stored to maintain stability?
The antibody is supplied in liquid form at 1 mg/mL concentration in PBS buffer at pH 7.4. It is stable for at least one year when stored at -20°C. To preserve antibody integrity, avoid multiple freeze-thaw cycles.
What is the immunogen used for raising the rabbit anti-ZIP Kinase polyclonal antibody and what is its clonality?
The antibody is a rabbit polyclonal IgG raised against a peptide corresponding to amino acids 279-298 of human ZIP kinase (accession no. BAA81746). It is peptide affinity purified to ensure specificity.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.