| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | T-Cell Cytokine Receptor (TCCR) (NT) |
| available sizes | 100 µg |
rabbit anti-TCCR (NT) polyclonal antibody 1242
$445.00
Antibody summary
- Rabbit polyclonal to TCCR (NT)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: Whole IgG
- 100 µg
rabbit anti-TCCR (NT) polyclonal antibody 1242
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 0.5-1 ug/mL. In immunoblots, a band of 70 kD is detected. Positive control: Human spleen tissue lysate. |
| Immunogen Peptide corresponding to aa 44-59 of human TCCR precursor. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens IL27RA Interleukin-27 receptor subunit alpha |
| Protein names Interleukin-27 receptor subunit alpha |
| Alternative names Cytokine receptor WSX-1, Cytokine receptor-like 1, Type I T-cell cytokine receptor, ZcytoR1 |
| Gene names IL27RA |
| Protein family Belongs to the type I cytokine receptor family. Type 2 subfamily |
| Function Receptor for IL27. Requires IL6ST/GP130 to mediate signal transduction in response to IL27. This signaling system acts through STAT3 and STAT1. Acts as a receptor for the neuroprotective peptide humanin as part of a complex with IL6ST/GP130 and CNTFR (PubMed:19386761). Involved in the regulation of Th1-type immune responses. Also appears to be involved in innate defense mechanisms |
| Subcellular location Membrane |
| Structure Component of a receptor complex composed of IL6ST/GP130, IL27RA/WSX1 and CNTFR which interacts with the neuroprotective peptide humanin |
| Keywords 3D-structure, Glycoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix |
| Sequence MRGGRGAPFWLWPLPKLALLPLLWVLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDL GAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFV NLETQMKPNAPRLGPDVDFSEDDPLEATVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLE PELKTIPLTPVEIQDLELATGYKVYGRCRMEKEEDLWGEWSPILSFQTPPSAPKDVWVSG NLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGITCCCSLIPSGAEWARVSA VNATSWEPLTNLSLVCLDSASAPRSVAVSSIAGSTELLVTWQPGPGEPLEHVVDWARDGD PLEKLNWVRLPPGNLSALLPGNFTVGVPYRITVTAVSASGLASASSVWGFREELAPLVGP TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQSGTSPSVCMNVSGNTQSVTLPDL PWGPCELWVTASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLLGCGLSLATSG RCYHLRHKVLPRWVWEKVPDPANSSSGQPHMEQVPEAQPLGDLPILEVEEMEPPPVMESS QPAQATAPLDSGYEKHFLPTPEELGLLGPPRPQVLA |
| UniProt accession: Q6UWB1 |
Data
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-TCCR (NT) polyclonal antibody 1242 validated for?
This antibody is suitable for use in Western blotting (WB), immunohistochemistry (IHC-P), immunofluorescence (IF), ELISA, and immunocytochemistry (ICC/IF). Recommended dilutions for immunoblotting are 0.5-1 µg/mL.
How should the rabbit anti-TCCR (NT) polyclonal antibody 1242 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-TCCR (NT) polyclonal antibody 1242?
The immunogen is a peptide corresponding to amino acids 44-59 of the human TCCR precursor protein.
Which secondary antibodies are compatible with the rabbit anti-TCCR (NT) polyclonal antibody 1242 for detection?
Compatible secondaries include goat anti-rabbit IgG antibodies that are H&L chain specific and conjugated with peroxidase, biotin, or FITC, including cross-absorbed variants for reduced background.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.













Reviews
There are no reviews yet.