| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | mouse |
| isotype | IgG |
| clonality | monoclonal |
| concentration | concentrate, predilute |
| applications | IHC |
| reactivity | human |
| available size | 0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted |
rabbit anti-Stathmin monoclonal antibody (ZR398) 6370
Price range: $160.00 through $528.00
Antibody summary
- Rabbit monoclonal to Stathmin
- Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
- Reacts with: Human
- Isotype:IgG
- Control: Brain or squamous cell carcinoma
- Visualization: Cytoplasmic
- 0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted
rabbit anti-Stathmin monoclonal antibody ZR398 6370
| target relevance |
|---|
| Homo sapiens STMN1 Stathmin |
| Protein names Stathmin |
| Alternative names Leukemia-associated phosphoprotein p18, Metablastin, Oncoprotein 18, Phosphoprotein p19, Prosolin, Protein Pr22, pp17 |
| Gene names STMN1 |
| Protein family Belongs to the stathmin family |
| Function Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity) |
| Subcellular location Cytoplasm, cytoskeleton |
| Structure Binds to two alpha/beta-tubulin heterodimers. Interacts with KIST |
| Post-translational modification Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. MAPK is responsible for the phosphorylation of stathmin in response to NGF. Phosphorylation at Ser-16 seems to be required for neuron polarization (By similarity). Phosphorylation at Ser-63 reduces tubulin binding 10-fold and suppresses the MT polymerization inhibition activity |
| Keywords Acetylation, Alternative splicing, Coiled coil, Cytoplasm, Cytoskeleton, Developmental protein, Differentiation, Direct protein sequencing, Methylation, Microtubule, Neurogenesis, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL ERLREKDKHIEEVRKNKESKDPADETEAD |
| UniProt accession: P16949 |
Data
 |
| Formalin-fixed, paraffin-embedded human cervical squamous cell carcinoma stained with anti-stathmin using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor cells |
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-Stathmin monoclonal antibody (ZR398) specifically react with, and what sample types is it validated for?
This rabbit monoclonal antibody specifically reacts with human Stathmin and is validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissue samples.
How should the rabbit anti-Stathmin antibody be stored to maintain its stability and activity?
The antibody should be stored at 2-8°C for short-term use. For long-term storage, it is recommended to keep the antibody at -20°C and avoid repeated freeze/thaw cycles to preserve its stability.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.