Immunohistochemistry (IHC) : Invasive cervical squamous cell carcinoma stained with anti-p16 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear and cytoplasmic staining of carcinoma cells.

mouse anti-p16INK4a monoclonal antibody (MX007) 6304

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to p16INK4a
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG1
Control: Cervical squamous cell carcinoma
Visualization: Cytoplasmic and nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6304parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Gynecological Pathology, p16INK4a

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG1
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-p16INK4a monoclonal antibody MX007 6304

antibody
Database link: human P42771
Tested applications IHC
Recommended dilutions Concentrated 1:100
Application Notes Positive control: Cervical squamous cell carcinoma
Immunogen Recombinant human p16INK4aprotein (aa1-156)
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG1
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG1 - Isotype Control

target relevance
Homo sapiens CDKN2A Cyclin-dependent kinase inhibitor 2A
Protein names Cyclin-dependent kinase inhibitor 2A
Alternative names Cyclin-dependent kinase 4 inhibitor A, Multiple tumor suppressor 1, p16-INK4a
Gene names CDKN2A
Protein family Belongs to the CDKN2 cyclin-dependent kinase inhibitor family
Function Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein
Subcellular location Cytoplasm, Nucleus
Structure Heterodimer with CDK4 or CDK6. Predominant p16 complexes contained CDK6. Interacts with CDK4 (both 'T-172'-phosphorylated and non-phosphorylated forms); the interaction inhibits cyclin D-CDK4 kinase activity. Interacts with ISCO2
Post-translational modification Phosphorylation seems to increase interaction with CDK4
Involvement in disease Melanoma, cutaneous malignant 2 A malignant neoplasm of melanocytes, arising de novo or from a pre-existing benign nevus, which occurs most often in the skin but may also involve other sites. Familial atypical multiple mole melanoma-pancreatic carcinoma syndrome An inherited cancer predisposition syndrome characterized by an increased risk of developing malignant melanoma and/or pancreatic cancer. Mutation carriers within families may develop either or both types of cancer. Melanoma-astrocytoma syndrome Characterized by a dual predisposition to melanoma and neural system tumors, commonly astrocytoma.
Keywords 3D-structure, Acetylation, Alternative splicing, ANK repeat, Cell cycle, Cytoplasm, Disease variant, Li-Fraumeni syndrome, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Tumor suppressor
Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
UniProt accession: P42771

Data

Invasive cervical squamous cell carcinoma stained with anti-p16 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear and cytoplasmic staining of carcinoma cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution for the concentrated mouse anti-p16INK4a monoclonal antibody (MX007) for immunohistochemistry?

The recommended dilution for the concentrated mouse anti-p16INK4a monoclonal antibody (MX007) in immunohistochemistry is 1:100.

Which species does the mouse anti-p16INK4a monoclonal antibody (MX007) specifically react with?

This antibody specifically reacts with human tissue samples.

How should the mouse anti-p16INK4a monoclonal antibody (MX007) be stored to maintain stability?

The antibody should be stored at 2-8°C for short-term use and at -20°C for long-term storage, avoiding freeze-thaw cycles to maintain stability.

What type of tissues is this antibody validated for use in, and what is the positive control recommended?

The antibody is suitable for immunohistochemistry on formalin-fixed, paraffin-embedded tissues, with cervical squamous cell carcinoma recommended as the positive control.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.