Immunohistochemistry (IHC) : Cervical invasive squamous cell carcinoma stained with anti-p16 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear and cytoplasmic staining of dysplastic cells.

mouse anti-p16INK4a monoclonal antibody (JC2) 6305

Price range: $160.00 through $528.00

Antibody summary

Mouse monoclonal to p16INK4a
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG2a
Control: Cervical squamous cell carcinoma
Visualization: Cytoplasmic and nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6305parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Gynecological Pathology, p16INK4a

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG2a
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

mouse anti-p16INK4a monoclonal antibody JC2 6305

antibody
Database link: human P42771
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Cervical squamous cell carcinoma
Immunogen Purified recombinant prokaryotic full length human p16INK4aprotein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG2a
Compatible secondaries goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody 5486 goat anti-mouse IgG, H&L chain specific, biotin conjugated, Conjugate polyclonal antibody 2685 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody 7854 goat anti-mouse IgG, H&L chain specific, peroxidase conjugated polyclonal antibody, crossabsorbed 1706 goat anti-mouse IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1716 goat anti-mouse IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1721
Isotype control Mouse monoclonal IgG2a - Isotype Control

target relevance
Homo sapiens CDKN2A Cyclin-dependent kinase inhibitor 2A
Protein names Cyclin-dependent kinase inhibitor 2A
Alternative names Cyclin-dependent kinase 4 inhibitor A, Multiple tumor suppressor 1, p16-INK4a
Gene names CDKN2A
Protein family Belongs to the CDKN2 cyclin-dependent kinase inhibitor family
Function Acts as a negative regulator of the proliferation of normal cells by interacting strongly with CDK4 and CDK6. This inhibits their ability to interact with cyclins D and to phosphorylate the retinoblastoma protein
Subcellular location Cytoplasm, Nucleus
Structure Heterodimer with CDK4 or CDK6. Predominant p16 complexes contained CDK6. Interacts with CDK4 (both 'T-172'-phosphorylated and non-phosphorylated forms); the interaction inhibits cyclin D-CDK4 kinase activity. Interacts with ISCO2
Post-translational modification Phosphorylation seems to increase interaction with CDK4
Involvement in disease Melanoma, cutaneous malignant 2 A malignant neoplasm of melanocytes, arising de novo or from a pre-existing benign nevus, which occurs most often in the skin but may also involve other sites. Familial atypical multiple mole melanoma-pancreatic carcinoma syndrome An inherited cancer predisposition syndrome characterized by an increased risk of developing malignant melanoma and/or pancreatic cancer. Mutation carriers within families may develop either or both types of cancer. Melanoma-astrocytoma syndrome Characterized by a dual predisposition to melanoma and neural system tumors, commonly astrocytoma.
Keywords 3D-structure, Acetylation, Alternative splicing, ANK repeat, Cell cycle, Cytoplasm, Disease variant, Li-Fraumeni syndrome, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Tumor suppressor
Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
UniProt accession: P42771

Data

Cervical invasive squamous cell carcinoma stained with anti-p16 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear and cytoplasmic staining of dysplastic cells.

FAQ & Publications

Frequently Asked Questions

What is the recommended dilution for using the mouse anti-p16INK4a monoclonal antibody (JC2) in immunohistochemistry?

For immunohistochemistry (IHC) applications, the concentrated mouse anti-p16INK4a monoclonal antibody (JC2) is recommended to be diluted between 1:100 and 1:200.

How should the mouse anti-p16INK4a monoclonal antibody (JC2) be stored to maintain its stability?

The antibody should be stored at 2-8°C for short-term storage. For long-term preservation, it is recommended to store the antibody at -20°C and to avoid repeated freeze/thaw cycles.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.