| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | STAT5A (phospho-Ser780) |
| available sizes | 100 µL |
rabbit anti-STAT5A (phospho-Ser780) polyclonal antibody 1924
$366.00
Antibody summary
- Rabbit polyclonal to STAT5A (phospho-Ser780)
- Suitable for: WB,IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-STAT5A (phospho-Ser780) polyclonal antibody 1924
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of~90kDa is detected. Immunohistochemistry: use at dilution of 1:50- 1:100. These are recommended working dilutions. End user should determine optimal dilutions for their applications. |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 780 (R-L-S(p)-P-P) derived from human STAT5A and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens STAT5A Signal transducer and activator of transcription 5A |
| Protein names Signal transducer and activator of transcription 5A |
| Gene names STAT5A |
| Protein family Belongs to the transcription factor STAT family |
| Function Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the GAS element and activates PRL-induced transcription. Regulates the expression of milk proteins during lactation |
| Subcellular location Cytoplasm, Nucleus |
| Structure Forms a homodimer or a heterodimer with a related family member. Binds NR3C1 (By similarity). Interacts with NCOA1 and SOCS7 (PubMed:12954634). Interacts with ERBB4 (PubMed:15534001). Interacts with EBF4 (PubMed:35939714). Interacts with CD69 (By similarity) |
| Post-translational modification Tyrosine phosphorylated in response to KITLG/SCF, IL2, IL3, IL7, IL15, CSF2/GMCSF, GH1, PRL, EPO and THPO (By similarity). Activated KIT promotes phosphorylation on tyrosine residues and subsequent translocation to the nucleus (PubMed:21135090). Tyrosine phosphorylated in response to constitutively activated FGFR1, FGFR2, FGFR3 and FGFR4 (By similarity). Tyrosine phosphorylation is required for DNA-binding activity and dimerization. Serine phosphorylation is also required for maximal transcriptional activity (By similarity). Tyrosine phosphorylated in response to signaling via activated FLT3; wild-type FLT3 results in much weaker phosphorylation than constitutively activated mutant FLT3 (PubMed:14504097). Alternatively, can be phosphorylated by JAK2 at Tyr-694 (PubMed:12529425) ISGylated |
| Keywords 3D-structure, Activator, Alternative splicing, Cytoplasm, DNA-binding, Lactation, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, SH2 domain, Transcription, Transcription regulation, Ubl conjugation |
| Sequence MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLV REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL RIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATY MDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS PPAGLFTSARGSLS |
| UniProt accession: P42229 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for using the rabbit anti-STAT5A (phospho-Ser780) polyclonal antibody in Western blot applications?
For Western blotting, it is recommended to use the antibody at a dilution between 1:500 and 1:1,000. At this dilution, a band of approximately 90 kDa is typically detected.
How should I store the rabbit anti-STAT5A (phospho-Ser780) polyclonal antibody to maintain its stability?
This antibody should be stored at -20°C where it remains stable for at least one year. It is supplied in a PBS buffer (without Mg2+ and Ca2+), pH 7.4, containing 150 mM NaCl.
Is this antibody suitable for immunohistochemistry (IHC) and what dilution should be used?
Yes, the antibody is suitable for immunohistochemistry. The recommended dilution range for IHC is between 1:50 and 1:100, although end users should optimize concentrations for their specific protocols.
What is the host species and clonality of this anti-STAT5A (phospho-Ser780) antibody?
The antibody is a rabbit polyclonal antibody of the IgG isotype.
What is the immunogen used to generate the rabbit anti-STAT5A (phospho-Ser780) polyclonal antibody?
The immunogen is a peptide sequence containing the phosphorylated serine 780 site (R-L-S(p)-P-P) derived from human STAT5A and conjugated to keyhole limpet hemocyanin (KLH).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.