| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | SERPINB13 |
| available sizes | 100 µg |
rabbit anti-SERPINB13 polyclonal antibody 4867
$376.00
Antibody summary
- Rabbit polyclonal to SERPINB13
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-SERPINB13 polyclonal antibody 4867
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. In immunoblots, a band of approximately 44 kD is detected. |
| Immunogen Peptide corresponding to aa 310-324 of human SERPINB13 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens SERPINB13 Serpin B13 |
| Protein names Serpin B13 |
| Alternative names HaCaT UV-repressible serpin, Headpin, Peptidase inhibitor 13, Proteinase inhibitor 13 |
| Gene names SERPINB13 |
| Protein family Belongs to the serpin family. Ov-serpin subfamily |
| Function May play a role in the proliferation or differentiation of keratinocytes |
| Subcellular location Cytoplasm |
| Keywords Alternative splicing, Cytoplasm, Protease inhibitor, Proteomics identification, Reference proteome, Serine protease inhibitor |
| Sequence MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSE KETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKY LDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNM VYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNN DLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVL AAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPG HENVHCNHPFLFFIRHNESNSILFFGRFSSP |
| UniProt accession: Q9UIV8 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-SERPINB13 polyclonal antibody 4867 been validated for?
This antibody has been tested and is suitable for Western blot (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should I store the rabbit anti-SERPINB13 polyclonal antibody to maintain its stability?
Store the antibody at -20°C, where it remains stable for at least one year. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to produce the rabbit anti-SERPINB13 polyclonal antibody 4867?
The immunogen is a peptide corresponding to amino acids 310-324 of the human SERPINB13 protein.
What is the recommended dilution range for using this antibody in Western blot?
For immunoblotting, the antibody should be used at a dilution between 1:500 and 1:1,000. It detects a band of approximately 44 kDa corresponding to SERPINB13.
Which secondary antibodies are compatible with the rabbit anti-SERPINB13 polyclonal antibody 4867?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific, conjugated with peroxidase, biotin, or FITC, including cross-absorbed variants for enhanced specificity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.