| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | SERPINB10 |
| available sizes | 100 µg |
rabbit anti-SERPINB10 polyclonal antibody 2319
$9,999.00
Antibody summary
- Rabbit polyclonal to SERPINB10
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-SERPINB10 polyclonal antibody 2319
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. In immunoblots, a band of approximately 45 kD is detected. |
| Immunogen Peptide corresponding to aa 316-330 of human SERPINB10 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens SERPINB10 Serpin B10 |
| Protein names Serpin B10 |
| Alternative names Bomapin, Peptidase inhibitor 10 |
| Gene names SERPINB10 |
| Protein family Belongs to the serpin family. Ov-serpin subfamily |
| Function Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus |
| Subcellular location Nucleus, Cytoplasm |
| Keywords Cytoplasm, Disulfide bond, Nucleus, Protease inhibitor, Proteomics identification, Reference proteome, Serine protease inhibitor |
| Sequence MDSLATSINQFALELSKKLAESAQGKNIFFSSWSISTSLTIVYLGAKGTTAAQMAQVLQF NRDQGVKCDPESEKKRKMEFNLSNSEEIHSDFQTLISEILKPNDDYLLKTANAIYGEKTY AFHNKYLEDMKTYFGAEPQPVNFVEASDQIRKDINSWVERQTEGKIQNLLPDDSVDSTTR MILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKKKLHIFHIEKPKAVGLQ LYYKSRDLSLLILLPEDINGLEQLEKAITYEKLNEWTSADMMELYEVQLHLPKFKLEDSY DLKSTLSSMGMSDAFSQSKADFSGMSSARNLFLSNVFHKAFVEINEQGTEAAAGSGSEID IRIRVPSIEFNANHPFLFFIRHNKTNTILFYGRLCSP |
| UniProt accession: P48595 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-SERPINB10 polyclonal antibody 2319 been validated for?
This antibody has been tested and is suitable for Western blotting (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should the rabbit anti-SERPINB10 polyclonal antibody 2319 be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.