| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | SARS Spike Protein |
| available sizes | 100 µL |
rabbit anti-SARS Spike Protein polyclonal antibody 1204
$551.00
Antibody summary
- Rabbit polyclonal to SARS Spike Protein
- Suitable for: ELISA
- Isotype: Whole IgG
- 100 µl
rabbit anti-SARS Spike Protein polyclonal antibody 1204
| antibody |
|---|
| Tested applications ELISA |
| Immunogen Synthetic peptide corresponding to amino acids at the center of SARS-CoV spike protein. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS, 0.02% NaN3. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Severe acute respiratory syndrome coronavirus S Spike glycoprotein |
| Protein names Spike glycoprotein |
| Alternative names E2, Peplomer protein |
| Gene names S |
| Protein family Belongs to the betacoronaviruses spike protein family |
| Function May down-regulate host tetherin (BST2) by lysosomal degradation, thereby counteracting its antiviral activity |
| Subcellular location Virion membrane, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Host cell membrane |
| Structure Homotrimer; each monomer consists of a S1 and a S2 subunit. The resulting peplomers protrude from the virus surface as spikes (By similarity). Binds to human and palm civet ACE2 and human CLEC4M/DC-SIGNR. Interacts with the accessory proteins 3a and 7a |
| Post-translational modification The cytoplasmic Cys-rich domain is palmitoylated. Spike glycoprotein is digested by cathepsin CTSL within endosomes Specific enzymatic cleavages in vivo yield mature proteins. The precursor is processed into S1 and S2 by host cell furin or another cellular protease to yield the mature S1 and S2 proteins. Additionally, a second cleavage leads to the release of a fusion peptide after viral attachment to host cell receptor The cytoplasmic Cys-rich domain is palmitoylated. Spike glycoprotein is digested within host endosomes |
| Keywords 3D-structure, Coiled coil, Disulfide bond, Fusion of virus membrane with host endosomal membrane, Fusion of virus membrane with host membrane, Glycoprotein, Host cell membrane, Host membrane, Host-virus interaction, Inhibition of host innate immune response by virus, Inhibition of host tetherin by virus, Lipoprotein, Membrane, Palmitate, Reference proteome, Signal, Transmembrane, Transmembrane helix, Viral attachment to host cell, Viral envelope protein, Viral immunoevasion, Viral penetration into host cytoplasm, Virion, Virulence, Virus entry into host cell |
| Sequence MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFL PFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNS TNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCTFEYISDAFSLDVSEKSGNFK HLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSP AQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIY QTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTF FSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCV LAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLND YGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTP SSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQD VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASY HTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDC NMYICGDSTECANLLLQYGSFCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFG GFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGL TVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYE NQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLN DILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSK RVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFN GTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKN HTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWL GFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT |
| UniProt accession: P59594 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-SARS Spike Protein polyclonal antibody 1204 been validated for?
This antibody has been tested and validated for use in ELISA, immunocytochemistry/immunofluorescence (ICC/IF), and western blot (WB) applications.
What are the recommended storage conditions for maintaining the stability of the rabbit anti-SARS Spike Protein polyclonal antibody 1204?
The antibody is stable for at least one year when stored at -20°C in its supplied storage buffer, which contains PBS and 0.02% sodium azide (NaN3).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.