| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | SARS Matrix Protein |
| available sizes | 100 µL |
rabbit anti-SARS Matrix Protein polyclonal antibody 7409
$551.00
Antibody summary
- Rabbit polyclonal to SARS Matrix Protein
- Suitable for: ELISA
- Isotype: Whole IgG
- 100 µl
rabbit anti-SARS Matrix Protein polyclonal antibody 7409
| antibody |
|---|
| Tested applications ELISA |
| Immunogen Synthetic peptide corresponding to the amino-terminus of SARS-CoV matrix protein. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS, 0.02% NaN3. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Severe acute respiratory syndrome coronavirus 2 VME1 Membrane protein |
| Protein names Membrane protein |
| Alternative names E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein |
| Protein family Belongs to the betacoronaviruses M protein family |
| Function Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins (By similarity). Regulates the localization of S protein at cis-Golgi, the place of virus budding (PubMed:33229438). May act by binding cytoplasmic c-terminus of S (PubMed:33229438) |
| Subcellular location Virion membrane, Host Golgi apparatus membrane, Host membrane |
| Structure Homomultimer (PubMed:35931673). Interacts with envelope E protein in the budding compartment of the host cell, which is located between endoplasmic reticulum and the Golgi complex (By similarity). Forms a complex with S proteins (PubMed:33229438). Interacts with nucleocapsid N protein. This interaction probably participates in RNA packaging into the virus (PubMed:35931673). Interacts with the accessory proteins 3a and 7a (By similarity) |
| Post-translational modification Glycosylated at N-terminus by host |
| Keywords 3D-structure, Glycoprotein, Host Golgi apparatus, Host membrane, Host-virus interaction, Membrane, Reference proteome, Transmembrane, Transmembrane helix, Viral envelope protein, Viral immunoevasion, Viral matrix protein, Virion |
| Sequence MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPV TLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILL NVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYK LGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ |
| UniProt accession: P0DTC5 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-SARS Matrix Protein polyclonal antibody 7409 been validated for?
This antibody has been tested and is suitable for ELISA, immunocytochemistry/immunofluorescence (ICC/IF), and Western blot (WB) applications.
How should the rabbit anti-SARS Matrix Protein polyclonal antibody 7409 be stored to maintain stability?
The antibody should be stored at -20°C, where it remains stable for at least one year.
What is the source and clonality of the SARS Matrix Protein antibody 7409?
The antibody is a rabbit polyclonal antibody of the IgG isotype.
What immunogen was used to generate the rabbit anti-SARS Matrix Protein polyclonal antibody 7409?
The immunogen is a synthetic peptide corresponding to the amino-terminus of the SARS-CoV matrix protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.