| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | WB |
| reactivity | Resistin |
| available sizes | 1 mg, 100 µg |
rabbit anti-resistin polyclonal antibody 5863
Price range: $376.00 through $2,415.00
Antibody summary
- Rabbit polyclonal to resistin
- Suitable for: WB
- Isotype: IgG
- 100 µg, 1 mg
rabbit anti-resistin polyclonal antibody 5863
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. In immunoblots, a band of approximately 14 kD is detected. |
| Immunogen Synthetic peptide corresponding to aa 94-102 of human resistin. |
| Size and concentration 100, 1000µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C to -70°C. Store antibody in appropriate aliquots to avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens RETN Resistin |
| Protein names Resistin |
| Alternative names Adipose tissue-specific secretory factor, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, Cysteine-rich secreted protein FIZZ3 |
| Gene names RETN |
| Protein family Belongs to the resistin/FIZZ family |
| Function Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells (By similarity). Potentially links obesity to diabetes (By similarity). Promotes chemotaxis in myeloid cells (PubMed:15064728) |
| Subcellular location Secreted |
| Structure Homodimer; disulfide-linked (By similarity). Interacts with DEFA1 (PubMed:15064728) |
| Keywords Alternative splicing, Diabetes mellitus, Disulfide bond, Hormone, Obesity, Proteomics identification, Reference proteome, Secreted, Signal |
| Sequence MKALCLLLLPVLGLLVSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDL ATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
| UniProt accession: Q9HD89 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution for using the rabbit anti-resistin polyclonal antibody 5863 in Western blotting?
For immunoblotting applications, the rabbit anti-resistin polyclonal antibody 5863 is recommended to be used at a dilution range of 1:500 to 1:1,000.
How should the rabbit anti-resistin polyclonal antibody 5863 be stored to maintain its stability?
This antibody should be stored at temperatures between -20°C and -70°C and kept in appropriate aliquots to avoid multiple freeze-thaw cycles. Under these conditions, it remains stable for at least one year.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.