| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | RAIDD (IN) |
| available sizes | 100 µg |
rabbit anti-RAIDD (IN) polyclonal antibody 1582
$445.00
Antibody summary
- Rabbit polyclonal to RAIDD (IN)
- Suitable for: ELISA,WB,ICC,IF
- Isotype: IgG
- 100 µg
rabbit anti-RAIDD (IN) polyclonal antibody 1582
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting : use at 1ug/mL. Positive control: HeLa or K562 cell lysate. Immunocytochemistry: use at 5ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 99- 117 of human RAIDD (accession no. AAB42217). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CRADD Death domain-containing protein CRADD |
| Protein names Death domain-containing protein CRADD |
| Alternative names Caspase and RIP adapter with death domain, RIP-associated protein with a death domain |
| Gene names CRADD |
| Function Adapter protein that associates with PIDD1 and the caspase CASP2 to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis (PubMed:15073321, PubMed:16652156, PubMed:17159900, PubMed:17289572, PubMed:9044836). Also recruits CASP2 to the TNFR-1 signaling complex through its interaction with RIPK1 and TRADD and may play a role in the tumor necrosis factor-mediated signaling pathway (PubMed:8985253) |
| Subcellular location Cytoplasm, Nucleus |
| Structure Forms a complex named the PIDDosome with PIDD1 and CASP2 (PubMed:15073321, PubMed:16652156, PubMed:17159900, PubMed:17289572, PubMed:8985253, PubMed:9044836). Interacts (via Death domain) with RIPK1 (via Death domain); the interaction is direct (PubMed:9044836). Interacts with TRADD (PubMed:8985253). Interacts with TNFRSF1A (PubMed:8985253) |
| Involvement in disease Intellectual developmental disorder, autosomal recessive 34, with variant lissencephaly A disorder characterized by mild to moderate intellectual disability, megalencephaly or enlarged head circumference, and a mild variant of lissencephaly with anterior-predominant pachygyria with shallow and unusually wide sulci and mildly thickened cortex. Some patients may have seizures. |
| Keywords 3D-structure, Alternative splicing, Apoptosis, Cytoplasm, Disease variant, Intellectual disability, Lissencephaly, Nucleus, Proteomics identification, Reference proteome |
| Sequence MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDI LPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQI NQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSL HNGLRAVEVDPSLLLHMLE |
| UniProt accession: P78560 |
Data
 |
| Western blot analysis of RAIDD in whole cell lysates from HeLa (H) or K562 (K) cells with RAIDD antibody at 1:500 dilution. |
 |
| Immunocytochemistry of RAIDD in HeLa cells with RAIDD antibody at 5 µg/mL. |
 |
| Immunofluorescence of RAIDD in Hela cells with RAIDD antibody at 20 µg/mL. |
 |
| Immunofluorescence of RAIDD in Hela cells with RAIDD antibody at 20 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-RAIDD (IN) polyclonal antibody 1582 validated for?
This antibody has been tested and is suitable for ELISA, Western blot (WB), Immunocytochemistry (ICC), and Immunofluorescence (IF) applications.
How should the rabbit anti-RAIDD (IN) antibody be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles.
What is the recommended dilution for using this antibody in immunoblotting and immunocytochemistry?
For immunoblotting, use the antibody at 1 µg/mL, and for immunocytochemistry, a concentration of 5 µg/mL is recommended. However, end users should optimize concentrations for their specific experimental conditions.
What is the immunogen used to generate the rabbit anti-RAIDD (IN) polyclonal antibody 1582?
The immunogen is a peptide corresponding to amino acids 99 to 117 of the human RAIDD protein (accession number AAB42217).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.