Skip to content

rabbit anti-PUMA (NT) polyclonal antibody 9434

$445.00

Antibody summary

  • Rabbit polyclonal to PUMA (NT)
  • Suitable for: ELISA,WB,IHC-P,IF
  • Isotype: IgG
  • 100 µg
SKU: 9434parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

PUMA (NT)

available sizes

100 µg

rabbit anti-PUMA (NT) polyclonal antibody 9434

antibody
Tested applications
WB,IHC,IHC,ICC/IF,ELISA
Recommended dilutions
Immunoblotting: use at 2ug/mL.

Positive control: K562 cell lysate.

Immunohistochemistry: use at 10ug/mL.

These are recommended concentrations.

Enduser should determine optimal concentrations for their applications.
Immunogen
Synthetic peptide corresponding to aa 2-16 of human PUMA-a (accession no. NP_055232).. This sequence is identical in mouse PUMA-a.
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
peptide affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens BBC3
Bcl-2-binding component 3, isoforms 1/2
Protein names
Bcl-2-binding component 3, isoforms 1/2
Alternative names
JFY-1, p53 up-regulated modulator of apoptosis
Gene names
BBC3
Protein family
Belongs to the Bcl-2 family
Function
Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis (PubMed:11463391, PubMed:23340338). Promotes partial unfolding of BCL2L1 and dissociation of BCL2L1 from p53/TP53, releasing the bound p53/TP53 to induce apoptosis (PubMed:23340338). Regulates ER stress-induced neuronal apoptosis (By similarity)
Subcellular location
Mitochondrion
Structure
Interacts with MCL1 and BCL2A1 (By similarity). Interacts (via BH3 domain) with BCL2 (PubMed:11463391). Interacts with BCL2L1/BCL-XL (PubMed:23340338). Interacts (via BH3 domain) with NOL3/ARC (via CARD domain); this interaction prevents BBC3 association with BCL2 and results in CASP8 activation (By similarity)
Keywords
3D-structure, Alternative splicing, Apoptosis, Mitochondrion, Phosphoprotein, Proteomics identification, Reference proteome
Sequence
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLC APTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPT QAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLP LPRGHRAPEMEPN
UniProt accession: Q9BXH1

Data

benchmark-antibodies_anti-puma_nt_antibody_9434_1.jpg
Western Blot Validation of PUMA in K562 Cells
Loading: 15 µg of lysates per lane. Antibodies: 9434 (2 µg/mL), 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution
benchmark-antibodies_anti-puma_nt_antibody_9434_2.gif
Independent Antibody Validation (IAV) via Protein Expression Profile in Human Cells
Loading: 20 µg of lysates per lane. Antibodies: 11007 (3 µg/mL), 9434 (2 µg/mL), beta-actin (1 µg/mL) and GAPDH (0.02 µg/mL), 1 h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-puma_nt_antibody_9434_3.gif
Immunofluorescence Validation of PUMA in K562 Cells
Immunofluorescent analysis of 4% paraformaldehyde-fixed K562 cells labeling PUMA with 9434 at 20 µg/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (red) and DAPI staining (blue).
benchmark-antibodies_anti-puma_nt_antibody_9434_4.jpg
Immunohistochemistry Validation of PUMA in Human Breast Carcinoma
Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue using anti-PUMA antibody (9434) at 10 µg/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.
benchmark-antibodies_anti-puma_nt_antibody_9434_5.gif
Immunohistochemistry Validation of PUMA in Human Breast Tissue
Immunohistochemical analysis of paraffin-embedded human breast tissue using anti-PUMA antibody (9434) at 2.5 µg/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.
benchmark-antibodies_anti-puma_nt_antibody_9434_6.jpg
Immunofluorescence Validation of PUMA in K562
Immunofluorescent analysis of 4% paraformaldehyde-fixed K562 cells labeling PUMA with 9434 at 10 µg/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (red). Image showing cytosol staining on K562 cells
benchmark-antibodies_anti-puma_nt_antibody_9434_7.gif
KO Validation of PUMA in Mouse Thymocytes (Michalak et al., 2008)
Western blot analysis ofthymocytes from wt, noxa knockout, puma knockout and noxa/puma double knockout mice cultured for 7 h in the presence or absence of 2.5 Gy g-irradiation.PUMA expression was not detected in puma KO and double KO mice with anti-PUMA antibodies (9434).
benchmark-antibodies_anti-puma_nt_antibody_9434_8.gif
KO Validation of PUMA in Mouse Cerebellar Neurons (Ambacher et al., 2012)
Puma expression is induced by potassium withdrawal in cerebellar granule neurons. After 7 days in culture CGNs were either maintained in media containing 25 mM potassium (K25) or switched to low potassium medium containing 5 mM potassium (K5). PUMA protein levels were analyzed by western blot with anti-PUMA antibodies (9434). PUMA expression was not detected in PUMA KO mice and was increased after treatment in WT.
benchmark-antibodies_anti-puma_nt_antibody_9434_9.gif
Induced Expression of PUMA in MCF7 cells (Wade et al., 2008)
Western analysis of MCF7 treated with the indicated dose of Nutlin-3a orABT-737 for 24h. Note that Puma is induced following Nutlin-3a treatment in these cells and PUMA expression was detected by anti-PUMA antibodies (9434)

FAQ & Publications

Frequently Asked Questions
What applications is the rabbit anti-PUMA (NT) polyclonal antibody suitable for?
This antibody is suitable for ELISA, Western Blot (WB), Immunohistochemistry (IHC), and Immunofluorescence (IF) applications.
What is the recommended dilution for using this antibody in immunohistochemistry?
For immunohistochemistry, it is recommended to use the antibody at a concentration of 10 µg/mL, although end users should optimize the concentration for their specific needs.
How should the rabbit anti-PUMA (NT) antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate this rabbit polyclonal antibody?
The immunogen is a synthetic peptide corresponding to amino acids 2-16 of human PUMA-alpha (accession no. NP_055232), which is identical in mouse PUMA-alpha.
Which secondary antibodies are compatible with this rabbit anti-PUMA (NT) polyclonal antibody?
Compatible secondary antibodies include goat anti-rabbit IgG H&L chain specific antibodies conjugated with peroxidase, biotin, or FITC, including cross-absorbed versions for enhanced specificity.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.