| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | PSDR1 |
| available sizes | 100 µg |
rabbit anti-PSDR1 polyclonal antibody 3728
$376.00
Antibody summary
- Rabbit polyclonal to PSDR1
- Suitable for: WB,ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-PSDR1 polyclonal antibody 3728
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution ELISA: use at 1:1,000-1:5,000 dilution. |
| Immunogen N-terminal sequence MVELMFP and C-terminal sequence LLGLPID of human PSDR1. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4 |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens RDH11 Retinol dehydrogenase 11 |
| Protein names Retinol dehydrogenase 11 |
| Alternative names Androgen-regulated short-chain dehydrogenase/reductase 1, HCV core-binding protein HCBP12, Prostate short-chain dehydrogenase/reductase 1, Retinal reductase 1, Short chain dehydrogenase/reductase family 7C member 1 |
| Gene names RDH11 |
| Protein family Belongs to the short-chain dehydrogenases/reductases (SDR) family |
| Function Retinol dehydrogenase with a clear preference for NADP. Displays high activity towards 9-cis, 11-cis and all-trans-retinol, and to a lesser extent on 13-cis-retinol (PubMed:12036956, PubMed:12226107, PubMed:29410696). Exhibits a low reductive activity towards unsaturated medium-chain aldehydes such as cis -6-nonenal and no activity toward nonanal or 4-hydroxy-nonenal (PubMed:15865448). Has no dehydrogenase activity towards steroid (PubMed:12036956, PubMed:12226107) |
| Catalytic activity all-trans-retinol + NADP(+) = all-trans-retinal + NADPH + H(+) 11-cis-retinol + NADP(+) = 11-cis-retinal + NADPH + H(+) 9-cis-retinol + NADP(+) = 9-cis-retinal + NADPH + H(+) 13-cis-retinol + NADP(+) = 13-cis-retinal + NADPH + H(+) |
| Subcellular location Endoplasmic reticulum membrane |
| Structure Interacts with SELENOF |
| Post-translational modification Not glycosylated |
| Involvement in disease Retinal dystrophy, juvenile cataracts, and short stature syndrome A disorder characterized by retinal dystrophy resulting in progressive decrease in visual acuity and difficulties with night vision in the first decade of life, development of juvenile cataracts, facial dysmorphism, psychomotor developmental delays, learning disabilities and short stature. Ophthalmological findings include salt-and-pepper retinopathy, attenuation of the arterioles, generalized rod-cone dysfunction, mottled macula at an early age, and peripapillary sparing of the retinal pigment epithelium. |
| Keywords Acetylation, Alternative splicing, Cataract, Dwarfism, Endoplasmic reticulum, Lipid metabolism, Membrane, NADP, Oxidoreductase, Proteomics identification, Reference proteome, Signal-anchor, Transmembrane, Transmembrane helix |
| Sequence MVELMFPLLLLLLPFLLYMAAPQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKE LAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKH LHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAH HLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELV RHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNET IARRLWDVSCDLLGLPID |
| UniProt accession: Q8TC12 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What species does the rabbit anti-PSDR1 polyclonal antibody 3728 react with?
This antibody is reactive to the human PSDR1 protein, also known as Retinol dehydrogenase 11.
Which applications has the rabbit anti-PSDR1 antibody been validated for?
The antibody has been tested and is suitable for Western blotting (WB) and ELISA applications, with recommended dilutions of 1:500-1:1,000 for WB and 1:1,000-1:5,000 for ELISA.
What are the storage conditions required to maintain the stability of the rabbit anti-PSDR1 polyclonal antibody?
The antibody should be stored at -20°C and is stable for at least one year under these conditions; multiple freeze-thaw cycles should be avoided to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-PSDR1 polyclonal antibody?
The antibody was raised against peptides corresponding to the N-terminal sequence MVELMFP and the C-terminal sequence LLGLPID of human PSDR1.
What is the format and concentration of the rabbit anti-PSDR1 polyclonal antibody provided?
The antibody is supplied as a liquid solution at a concentration of 1 mg/mL, with a size of 100 µg per vial.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.