| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Prostein |
| available sizes | 100 µg |
rabbit anti-Prostein polyclonal antibody 9867
$376.00
Antibody summary
- Rabbit polyclonal to Prostein
- Suitable for: WB,ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-Prostein polyclonal antibody 9867
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution ELISA: use at 1:1,000-1:5,000 dilution. |
| Immunogen N-terminal sequence ITYVPPLLLEVGVEE and C-terminal Sequence FATQVVFDKSDLAKYSA of human prostein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity protein affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens SLC45A3 Solute carrier family 45 member 3 |
| Protein names Solute carrier family 45 member 3 |
| Alternative names Prostate cancer-associated protein 6, Prostein |
| Gene names SLC45A3 |
| Protein family Belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family |
| Function Proton-associated sucrose transporter. May be able to transport also glucose and fructose |
| Catalytic activity sucrose(out) + H(+)(out) = sucrose(in) + H(+)(in) |
| Subcellular location Membrane |
| Keywords Membrane, Proteomics identification, Reference proteome, Symport, Transmembrane, Transmembrane helix, Transport |
| Sequence MVQRLWVSRLLRHRKAQLLLVNLLTFGLEVCLAAGITYVPPLLLEVGVEEKFMTMVLGIG PVLGLVCVPLLGSASDHWRGRYGRRRPFIWALSLGILLSLFLIPRAGWLAGLLCPDPRPL ELALLILGVGLLDFCGQVCFTPLEALLSDLFRDPDHCRQAYSVYAFMISLGGCLGYLLPA IDWDTSALAPYLGTQEECLFGLLTLIFLTCVAATLLVAEEAALGPTEPAEGLSAPSLSPH CCPCRARLAFRNLGALLPRLHQLCCRMPRTLRRLFVAELCSWMALMTFTLFYTDFVGEGL YQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFSLVMDRLVQRFGTRAVYLASVA AFPVAAGATCLSHSVAVVTASAALTGFTFSALQILPYTLASLYHREKQVFLPKYRGDTGG ASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEA RVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQ VVFDKSDLAKYSA |
| UniProt accession: Q96JT2 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-Prostein polyclonal antibody 9867 been validated for?
This antibody has been tested and validated for use in Western blot (WB) and ELISA assays.
What are the recommended dilution ranges for this antibody in immunoblotting and ELISA?
For immunoblotting, use a dilution of 1:500 to 1:1,000, and for ELISA, use a dilution of 1:1,000 to 1:5,000.
How should the rabbit anti-Prostein polyclonal antibody 9867 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year. Avoid repeated freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate this rabbit anti-Prostein polyclonal antibody?
The immunogen consists of the N-terminal peptide sequence ITYVPPLLLEVGVEE and the C-terminal peptide sequence FATQVVFDKSDLAKYSA of human Prostein protein.
Which secondary antibodies are compatible with this rabbit anti-Prostein polyclonal antibody?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific antibodies conjugated to peroxidase, biotin, or FITC, including cross-absorbed variants for enhanced specificity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.