| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | PRCP (Angiotensinase C) |
| available sizes | 100 µL |
rabbit anti-PRCP (Angiotensinase C) polyclonal antibody 6417
$351.00
Antibody summary
- Rabbit polyclonal to PRCP (Angiotensinase C)
- Suitable for: ELISA
- Isotype: Whole IgG
- 100 µl
rabbit anti-PRCP (Angiotensinase C) polyclonal antibody 6417
| antibody |
|---|
| Tested applications ELISA |
| Immunogen Recombinant fusion protein corresponding to aa 46-317 of human PRCP. |
| Size and concentration 100µL and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS, 0.05% NaN3, 50% glycerol. |
| Purity protein affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens PRCP Lysosomal Pro-X carboxypeptidase |
| Protein names Lysosomal Pro-X carboxypeptidase |
| Alternative names Angiotensinase C, Lysosomal carboxypeptidase C, Proline carboxypeptidase, Prolylcarboxypeptidase |
| Gene names PRCP |
| Protein family Belongs to the peptidase S28 family |
| Function Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH |
| Catalytic activity Cleavage of a -Pro-|-Xaa bond to release a C-terminal amino acid. |
| Subcellular location Lysosome |
| Structure Homodimer |
| Keywords 3D-structure, Alternative splicing, Carboxypeptidase, Direct protein sequencing, Disulfide bond, Glycoprotein, Hydrolase, Lysosome, Protease, Proteomics identification, Reference proteome, Signal, Zymogen |
| Sequence MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH MKNWIRDFYDSAGKQH |
| UniProt accession: P42785 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the immunogen used to generate the rabbit anti-PRCP (Angiotensinase C) polyclonal antibody 6417?
The immunogen is a recombinant fusion protein corresponding to amino acids 46-317 of human PRCP.
Which applications has this antibody been tested for?
This antibody has been tested for use in ELISA, Immunocytochemistry/Immunofluorescence (ICC/IF), and Western Blotting (WB) applications.
How should the rabbit anti-PRCP polyclonal antibody 6417 be stored to ensure stability?
The antibody should be stored at -20°C, where it remains stable for at least one year. It is supplied in PBS with 0.05% sodium azide and 50% glycerol.
What type of antibody is the rabbit anti-PRCP (Angiotensinase C) polyclonal antibody 6417 and what is its concentration?
This product is a rabbit polyclonal whole IgG antibody with a concentration of 1 mg/mL.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| ELISA |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.