| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | PRAC |
| available sizes | 100 µg |
rabbit anti-PRAC polyclonal antibody 2244
$376.00
Antibody summary
- Rabbit polyclonal to PRAC
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-PRAC polyclonal antibody 2244
| target relevance |
|---|
| Homo sapiens PRAC1 Small nuclear protein PRAC1 |
| Protein names Small nuclear protein PRAC1 |
| Alternative names Prostate cancer susceptibility candidate protein 1, Prostate, rectum and colon expressed gene protein |
| Gene names PRAC1 |
| Subcellular location Nucleus |
| Keywords Nucleus, Reference proteome |
| Sequence MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP |
| UniProt accession: Q96KF2 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-PRAC polyclonal antibody 2244 validated for?
The antibody is validated for Western blot (WB) and immunocytochemistry/immunofluorescence (ICC/IF) applications.
How should the rabbit anti-PRAC polyclonal antibody 2244 be stored to maintain stability?
This antibody should be stored at -70°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the recommended dilution range for Western blotting using this PRAC antibody?
For immunoblotting applications, the antibody is recommended to be used at a dilution between 1:500 and 1:1,000, where it detects a protein band of approximately 6 kDa.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.