Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human colon adenocarcinoma (Lynch Syndrome) stained with anti-PMS-2 antibody. Note tumor cells are negative whereas normal glands (top) are nuclear positive.

rabbit anti-PMS-2 monoclonal antibody (ZR317) 6433

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to PMS-2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Colon
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6433parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, GI Pathology, monoclonal, PMS-2

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-PMS-2 monoclonal antibody ZR317 6433

antibody
Database link: human P54277
Tested applications IHC
Recommended dilutions Concentrated 1:50-100
Application Notes Colon
Immunogen Recombinant full-length human ALPP protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens PMS1 PMS1 protein homolog 1
Protein names PMS1 protein homolog 1
Alternative names DNA mismatch repair protein PMS1
Gene names PMS1
Protein family Belongs to the DNA mismatch repair MutL/HexB family
Function Probably involved in the repair of mismatches in DNA
Subcellular location Nucleus
Structure Component of the DNA mismatch repair (MMR) complex composed at least of MSH2, MSH3, MSH6, PMS1 and MLH1 (PubMed:26300262). The MutL-beta complex is a heterodimer of PMS1 and MLH1 (PubMed:10748105). Interacts with MCM9 (PubMed:26300262)
Keywords 3D-structure, Alternative splicing, DNA damage, DNA repair, DNA-binding, Hereditary nonpolyposis colorectal cancer, Nucleus, Proteomics identification, Reference proteome, Tumor suppressor
Sequence MKQLPAATVRLLSSSQIITSVVSVVKELIENSLDAGATSVDVKLENYGFDKIEVRDNGEG IKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQ YVLDGSGHILSQKPSHLGQGTTVTALRLFKNLPVRKQFYSTAKKCKDEIKKIQDLLMSFG ILKPDLRIVFVHNKAVIWQKSRVSDHKMALMSVLGTAVMNNMESFQYHSEESQIYLSGFL PKCDADHSFTSLSTPERSFIFINSRPVHQKDILKLIRHHYNLKCLKESTRLYPVFFLKID VPTADVDVNLTPDKSQVLLQNKESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVL SKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGH CSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGE NEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMN LNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLED ATLQIEELWKTLSEEEKLKYEEKATKDLERYNSQMKRAIEQESQMSLKDGRKKIKPTSAW NLAQKHKLKTSLSNQPKLDELLQSQIEKRRSQNIKMVQIPFSMKNLKINFKKQNKVDLEE KDEPCLIHNLRFPDAWLMTSKTEVMLLNPYRVEEALLFKRLLENHKLPAEPLEKPIMLTE SLFNGSHYLDVLYKMTADDQRYSGSTYLSDPRLTANGFKIKLIPGVSITENYLEIEGMAN CLPFYGVADLKEILNAILNRNAKEVYECRPRKVISYLEGEAVRLSRQLPMYLSKEDIQDI IYRMKHQFGNEIKECVHGRPFFHHLTYLPETT
UniProt accession: P54277

Data

Formalin-fixed, paraffin-embedded human colon adenocarcinoma (Lynch Syndrome) stained with anti-PMS-2 antibody. Note tumor cells are negative whereas normal glands (top) are nuclear positive.

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-PMS-2 monoclonal antibody (ZR317) specifically react with?

This antibody specifically reacts with human PMS-2 protein.

What is the recommended application and dilution range for using this antibody in immunohistochemistry?

The antibody is suitable for immunohistochemistry on formalin-fixed, paraffin-embedded tissues, with a recommended dilution range of 1:50 to 1:100 when using the concentrated form.

How should the rabbit anti-PMS-2 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C and freeze/thaw cycles should be avoided.

What is the host species and clonality of this anti-PMS-2 antibody?

The antibody is a rabbit monoclonal antibody, and its isotype is IgG.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.