Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human colon stained with anti-SATB2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of glandular cells

rabbit anti-SATB2 monoclonal antibody (ZR167) 6361

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to SATB2
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Colon or colon cancer
Visualization: Nuclear
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6361parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, GI Pathology, SATB2

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-SATB2 monoclonal antibody ZR167 6361

antibody
Database link: human Q9UPW6
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Colon or colon cancer
Immunogen Recombinant fragment (around aa150-350) of human SATB2 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens SATB2 DNA-binding protein SATB2
Protein names DNA-binding protein SATB2
Alternative names Special AT-rich sequence-binding protein 2
Gene names SATB2
Protein family Belongs to the CUT homeobox family
Function Binds to DNA, at nuclear matrix- or scaffold-associated regions. Thought to recognize the sugar-phosphate structure of double-stranded DNA. Transcription factor controlling nuclear gene expression, by binding to matrix attachment regions (MARs) of DNA and inducing a local chromatin-loop remodeling. Acts as a docking site for several chromatin remodeling enzymes and also by recruiting corepressors (HDACs) or coactivators (HATs) directly to promoters and enhancers. Required for the initiation of the upper-layer neurons (UL1) specific genetic program and for the inactivation of deep-layer neurons (DL) and UL2 specific genes, probably by modulating BCL11B expression. Repressor of Ctip2 and regulatory determinant of corticocortical connections in the developing cerebral cortex. May play an important role in palate formation. Acts as a molecular node in a transcriptional network regulating skeletal development and osteoblast differentiation
Subcellular location Nucleus matrix
Structure Interacts with ATF4 and RUNX2; resulting in enhanced DNA binding and transactivation by these transcription factors (By similarity). Interacts with PIAS1
Post-translational modification Sumoylated by PIAS1. Sumoylation promotes nuclear localization, but represses transcription factor activity
Involvement in disease Cleft palate isolated A congenital fissure of the soft and/or hard palate, due to faulty fusion. Isolated cleft palate is not associated with cleft lips. Some patients may manifest other craniofacial dysmorphic features, intellectual disability, and osteoporosis.
Keywords 3D-structure, Alternative splicing, Chromatin regulator, Chromosomal rearrangement, Developmental protein, Disease variant, DNA-binding, Homeobox, Intellectual disability, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Repressor, Transcription, Transcription regulation, Ubl conjugation
Sequence MERRSESPCLRDSPDRRSGSPDVKGPPPVKVARLEQNGSPMGARGRPNGAVAKAVGGLMI PVFCVVEQLDGSLEYDNREEHAEFVLVRKDVLFSQLVETALLALGYSHSSAAQAQGIIKL GRWNPLPLSYVTDAPDATVADMLQDVYHVVTLKIQLQSCSKLEDLPAEQWNHATVRNALK ELLKEMNQSTLAKECPLSQSMISSIVNSTYYANVSATKCQEFGRWYKKYKKIKVERVERE NLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTPIRNQVPALQPIMSPGLLSP QLSPQLVRQQIAMAHLINQQIAVSRLLAHQHPQAINQQFLNHPPIPRAVKPEPTNSSVEV SPDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILRKEEDPRTASQSLLVNLRAMQN FLNLPEVERDRIYQDERERSMNPNVSMVSSASSSPSSSRTPQAKTSTPTTDLPIKVDGAN INITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWLCELLRWKENPSPENRTLWENLCT IRRFLNLPQHERDVIYEEESRHHHSERMQHVVQLPPEPVQVLHRQQSQPAKESSPPREEA PPPPPPTEDSCAKKPRSRTKISLEALGILQSFIHDVGLYPDQEAIHTLSAQLDLPKHTII KFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENA DKSKAAPAEIDQR
UniProt accession: Q9UPW6

Data

Formalin-fixed, paraffin-embedded human colon stained with anti-SATB2 antibody using peroxidase-conjugate and DAB chromogen. Note nuclear staining of glandular cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-SATB2 monoclonal antibody (ZR167) specifically react with?

The rabbit anti-SATB2 monoclonal antibody (ZR167) specifically reacts with human SATB2 protein.

Which applications is the rabbit anti-SATB2 monoclonal antibody (ZR167) validated for?

This antibody is validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded tissues.

What are the recommended storage conditions for the rabbit anti-SATB2 monoclonal antibody (ZR167)?

For short-term storage, keep the antibody at 2-8°C. For long-term storage, it should be kept at -20°C while avoiding freeze/thaw cycles.

What is the immunogen used to generate the rabbit anti-SATB2 monoclonal antibody (ZR167)?

The immunogen is a recombinant fragment of the human SATB2 protein, approximately amino acids 150-350.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.