| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | PHAP III |
| available sizes | 100 µg |
rabbit anti-PHAP III polyclonal antibody 8922
$445.00
Antibody summary
- Rabbit polyclonal to PHAP III
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-PHAP III polyclonal antibody 8922
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Western Blot: Use at 1ug/ml. Positive control: A549 cell lysate. Immunohistochemistry: use at 2ug/ml. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Synthetic peptide corresponding to amino acids near the carboxy terminus of human PHAP III (accession no. NP_112182) |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens ANP32E Acidic leucine-rich nuclear phosphoprotein 32 family member E |
| Protein names Acidic leucine-rich nuclear phosphoprotein 32 family member E |
| Alternative names LANP-like protein |
| Gene names ANP32E |
| Protein family Belongs to the ANP32 family |
| Function Histone chaperone that specifically mediates the genome-wide removal of histone H2A.Z/H2AZ1 from the nucleosome: removes H2A.Z/H2AZ1 from its normal sites of deposition, especially from enhancer and insulator regions. Not involved in deposition of H2A.Z/H2AZ1 in the nucleosome. May stabilize the evicted H2A.Z/H2AZ1-H2B dimer, thus shifting the equilibrium towards dissociation and the off-chromatin state (PubMed:24463511). Inhibits activity of protein phosphatase 2A (PP2A). Does not inhibit protein phosphatase 1. May play a role in cerebellar development and synaptogenesis |
| Subcellular location Cytoplasm, Nucleus |
| Structure Interacts with the importin alpha KPNA1 and KPNA2 (By similarity). Component of a SWR1-like complex, composed of EP400, KAT5/TIP60, TRRAP, BRD8, RUVBL1, RUVBL2, ING3 and ANP32E; the complex does not contain SRCAP. Interacts with H2A.Z/H2AZ1 |
| Post-translational modification Phosphorylated. The phosphorylation is nuclear localization signal (NLS)-dependent (By similarity) |
| Keywords 3D-structure, Acetylation, Alternative splicing, Chaperone, Chromatin regulator, Cytoplasm, Isopeptide bond, Leucine-rich repeat, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Ubl conjugation |
| Sequence MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARL PSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDL FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEDDEDGDEDDEEEEENEAGP PEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGE EEEEEEEGGLRGEKRKRDAEDDGEEEDD |
| UniProt accession: Q9BTT0 |
Data
 |
| Western blot analysis of PHAP III expression in human A549 (A) and HepG2 (B) cells, and rat testis (C) with PHAP antibody III at 1 µg/mL. |
 |
| Immunohistochemistry of PHAP III in human small intestine tissue with PHAP III antibody at 2 µg/mL. |
 |
| Immunofluorescence of PHAP III in Human Small Intestine cells with PHAP III antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-PHAP III polyclonal antibody 8922 been validated for?
This antibody has been tested and validated for use in Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry/Immunofluorescence (ICC/IF), and ELISA assays.
How should the rabbit anti-PHAP III polyclonal antibody be stored to maintain its stability?
The antibody is stable for at least one year when stored at -20°C. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the recommended dilution for using this antibody in Western blot and immunohistochemistry?
For Western blot applications, use the antibody at 1 µg/mL with A549 cell lysate as a positive control. For immunohistochemistry, a concentration of 2 µg/mL is recommended. These are suggested starting points, and users should optimize concentrations for their specific applications.
What is the immunogen used to generate the rabbit anti-PHAP III polyclonal antibody 8922?
The immunogen is a synthetic peptide corresponding to amino acids near the carboxy terminus of human PHAP III, based on accession number NP_112182.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.