Skip to content

rabbit anti-PHAP I (IN) polyclonal antibody 8265

$445.00

Antibody summary

  • Rabbit polyclonal to PHAP I (IN)
  • Suitable for: ELISA,WB,ICC,IF
  • Isotype: IgG
  • 100 µg
SKU: 8265parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

PHAP I (IN)

available sizes

100 µg

rabbit anti-PHAP I (IN) polyclonal antibody 8265

antibody
Tested applications
WB,ICC/IF,ELISA
Recommended dilutions
Immunoblotting: Use at 2-4 ug/mL.

Positive control: Raji cell lysate.

Immunocytochemistry: use at 2ug/mL.

These are recommended concentrations.

Enduser should determine optimal concentrations for their applications.
Immunogen
Synthetic peptide corresponding to amino acids near the carboxy terminus of human PHAP I (accession no. P39687).
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
peptide affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens ANP32A
Acidic leucine-rich nuclear phosphoprotein 32 family member A
Protein names
Acidic leucine-rich nuclear phosphoprotein 32 family member A
Alternative names
Acidic nuclear phosphoprotein pp32, Leucine-rich acidic nuclear protein, Mapmodulin, Potent heat-stable protein phosphatase 2A inhibitor I1PP2A, Putative HLA-DR-associated protein I
Gene names
ANP32A
Protein family
Belongs to the ANP32 family
Function
Multifunctional protein that is involved in the regulation of many processes including tumor suppression, apoptosis, cell cycle progression or transcription (PubMed:10400610, PubMed:11360199, PubMed:16341127, PubMed:18439902). Promotes apoptosis by favouring the activation of caspase-9/CASP9 and allowing apoptosome formation (PubMed:18439902). In addition, plays a role in the modulation of histone acetylation and transcription as part of the INHAT (inhibitor of histone acetyltransferases) complex. Inhibits the histone-acetyltranferase activity of EP300/CREBBP (CREB-binding protein) and EP300/CREBBP-associated factor by histone masking (PubMed:11830591). Preferentially binds to unmodified histone H3 and sterically inhibiting its acetylation and phosphorylation leading to cell growth inhibition (PubMed:16341127). Participates in other biochemical processes such as regulation of mRNA nuclear-to-cytoplasmic translocation and stability by its association with ELAVL1 (Hu-antigen R) (PubMed:18180367). Plays a role in E4F1-mediated transcriptional repression as well as inhibition of protein phosphatase 2A (PubMed:15642345, PubMed:17557114)
Subcellular location
Nucleus, Cytoplasm, Endoplasmic reticulum
Structure
(Microbial infection) Interacts (via C-terminus) with influenza virus C protein PB2; this interaction promotes viral replication by bridging viral replicase dimers together
Post-translational modification
Phosphorylated on serine residues, at least in part by casein kinase 2/CK2
The N-terminus is blocked
Some glutamate residues are glycylated by TTLL8. This modification occurs exclusively on glutamate residues and results in a glycine chain on the gamma-carboxyl group (By similarity)
Keywords
3D-structure, Cytoplasm, Direct protein sequencing, Endoplasmic reticulum, Host-virus interaction, Leucine-rich repeat, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Repeat, Repressor, Transcription, Transcription regulation
Sequence
MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANL PKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDL FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKRE PEDEGEDDD
UniProt accession: P39687

Data

benchmark-antibodies_anti-phap_i_in_antibody_8265_1.jpg
Western Blot Validation in Human Raji Cell Lysate
Loading: 15 µg of lysates per lane. Antibodies: PHAP I 8265 (A: 2 µg/mL, B: 4 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-phap_i_in_antibody_8265_2.gif
Independent Antibody Validation (IAV) via Protein Expression Profile in Cell Lines
Loading: 15 µg of lysates per lane. Antibodies: PHAP I 8265 (2 µg/mL), PHAP I 11088 (1 µg/mL), and beta-actin (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-phap_i_in_antibody_8265_3.gif
Western Blot Validation in Human Cell Lines
Loading: 15 µg of lysates per lane. Antibodies: PHAP I 8265 (2 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-phap_i_in_antibody_8265_4.jpg
Immunofluorescence Validation of PHAP I in Raji Cells
Immunofluorescent analysis of 4% paraformaldehyde-fixed Raji Cells labeling PHAP I with 8265 at 10 µg/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (red).
benchmark-antibodies_anti-phap_i_in_antibody_8265_5.jpg
Immunocytochemistry Validation of PHAP I in Raji Cells
Immunocytochemical analysis of Raji cells using anti-PHAP I antibody (8265) at 2 µg/mL. Cells was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.
benchmark-antibodies_anti-phap_i_in_antibody_8265_6.gif
KD Validation of PHAPI in Human Breast Cancer Cells (Schafer et al., 2006)
Human Breast Cancer Cells (T47D cells) were transfected with control or PHAPI siRNA duplex. PHAPI was detected via Western Blot analysis by using the anti-PHAPI antibody. PHAPI expression was reduced after PHAPI siRNA knockdown.
benchmark-antibodies_anti-phap_i_in_antibody_8265_7.gif
Increased Expression Validation of PHAPI in Patient Samples of BreastTumor Tissue (Schafer et al., 2006)
PHAPI was overexpressed in all breast tumor samples of patients and human breast cancer cells (MDA-MB-453), but not in the normal breast tissue or human primary mammary epithelial cells (HMEC).
benchmark-antibodies_anti-phap_i_in_antibody_8265_8.gif
Overexpression of PHAPI in Breast Cancer Cells (Schafer et al., 2006)
Western blot analysis with anti-PHAPI antibodies was performed for PHAPI in human cell lines from breast, prostate and lung. PHAPI was overexpressed in breast cancer cells when compared with normal cells (HMEC) whereas there were no significant differences in PHAPI expression in normal and cancer cells of either prostate or lung origin.
benchmark-antibodies_anti-phap_i_in_antibody_8265_9.gif
Induced Expression Validation of PHAPI/Anp32a in Atxn1 KO Mice (Sanchez et al., 2412)
Western blot analysis of PHAPI/Anp32a from the cerebellum of WT and Atxn1 KO mice. PHAPI expression was significantly increased (2 folds) in Atxn1 KO mice as compared to WT mice. The same effect was observed in PHAPI mRNA levels.

FAQ & Publications

Frequently Asked Questions
What applications is the rabbit anti-PHAP I (IN) polyclonal antibody 8265 validated for?
This antibody has been tested and is suitable for ELISA, Western blotting (WB), immunocytochemistry (ICC), and immunofluorescence (IF) applications.
How should the rabbit anti-PHAP I (IN) antibody 8265 be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is advised to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the recommended dilution for using the PHAP I (IN) antibody 8265 in immunoblotting and immunocytochemistry?
For immunoblotting, use the antibody at 2-4 µg/mL, and for immunocytochemistry, a concentration of 2 µg/mL is recommended. However, end users should optimize the concentration based on their specific experimental conditions.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.