| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | p8 (CT) |
| available sizes | 100 µg |
rabbit anti-p8 (CT) polyclonal antibody 7283
$376.00
Antibody summary
- Rabbit polyclonal to p8 (CT)
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-p8 (CT) polyclonal antibody 7283
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. In immunoblots, a band of approximately 8 kD is detected. |
| Immunogen Peptide corresponding to the C-terminus of human p8 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens NUPR1 Nuclear protein 1 |
| Protein names Nuclear protein 1 |
| Alternative names Candidate of metastasis 1, Protein p8 |
| Gene names NUPR1 |
| Protein family Belongs to the NUPR family |
| Function Transcription regulator that converts stress signals into a program of gene expression that empowers cells with resistance to the stress induced by a change in their microenvironment. Thereby participates in the regulation of many processes namely cell-cycle, apoptosis, autophagy and DNA repair responses (PubMed:11056169, PubMed:11940591, PubMed:16300740, PubMed:16478804, PubMed:18690848, PubMed:19650074, PubMed:19723804, PubMed:20181828, PubMed:22565310, PubMed:22858377, PubMed:30451898). Controls cell cycle progression and protects cells from genotoxic stress induced by doxorubicin through the complex formation with TP53 and EP300 that binds CDKN1A promoter leading to transcriptional induction of CDKN1A (PubMed:18690848). Protects pancreatic cancer cells from stress-induced cell death by binding the RELB promoter and activating its transcription, leading to IER3 transactivation (PubMed:22565310). Negatively regulates apoptosis through interaction with PTMA (PubMed:16478804). Inhibits autophagy-induced apoptosis in cardiac cells through FOXO3 interaction, inducing cytoplasmic translocation of FOXO3 thereby preventing the FOXO3 association with the pro-autophagic BNIP3 promoter (PubMed:20181828). Inhibits cell growth and facilitates programmed cell death by apoptosis after adriamycin-induced DNA damage through transactivation of TP53 (By similarity). Regulates methamphetamine-induced apoptosis and autophagy through DDIT3-mediated endoplasmic reticulum stress pathway (By similarity). Participates in DNA repair following gamma-irradiation by facilitating DNA access of the transcription machinery through interaction with MSL1 leading to inhibition of histone H4' Lys-16' acetylation (H4K16ac) (PubMed:19650074). Coactivator of PAX2 transcription factor activity, both by recruiting EP300 to increase PAX2 transcription factor activity and by binding PAXIP1 to suppress PAXIP1-induced inhibition on PAX2 (PubMed:11940591). Positively regulates cell cycle progression through interaction with COPS5 inducing cytoplasmic translocation of CDKN1B leading to the CDKN1B degradation (PubMed:16300740). Coordinates, through its interaction with EP300, the association of MYOD1, EP300 and DDX5 to the MYOG promoter, leading to inhibition of cell-cycle progression and myogenic differentiation promotion (PubMed:19723804). Negatively regulates beta cell proliferation via inhibition of cell-cycle regulatory genes expression through the suppression of their promoter activities (By similarity). Also required for LHB expression and ovarian maturation (By similarity). Exacerbates CNS inflammation and demyelination upon cuprizone treatment (By similarity) |
| Subcellular location Nucleus, Cytoplasm, Cytoplasm, perinuclear region |
| Structure Monomer. Directly interacts with MSL1 and binds MORF4L1, two components of histone acetyltransferase complex; the interaction with MORF4L1 may be mediated by MSL1 (PubMed:19650074). Interacts with EP300; this interaction enhances the effect of EP300 on PAX2 transcription factor activity (PubMed:11940591). Interacts with PAXIP1; this interaction prevents PAXIP1 inhibition of PAX2 transcription factor activity (PubMed:11940591). Interacts with COPS5; this interaction allows COPS5-dependent CDKN1B nuclear to cytoplasm translocation (PubMed:16300740). Interacts with RNF2 (PubMed:28720707). Interacts with FOXO3; this interaction represses FOXO3 transactivation (PubMed:20181828). Interacts with PTMA; negatively regulates apoptotic process (PubMed:16478804). Interacts with MYOD1, EP300 and DDX5; this interaction coordinates the association of anti-proliferative and pro-myogenic proteins at the myogenin promoter (By similarity) (PubMed:19723804). Interacts with TP53; interaction is stress-dependent (PubMed:18690848). Forms a complex with EP300 and TP53; this complex binds CDKN1A promoter leading to transcriptional induction of CDKN1A (PubMed:18690848) |
| Post-translational modification Phosphorylated in vitro by PKA and CK. Phosphorylation promotes DNA-binding activity Acetylated by EP300 in vitro |
| Keywords Activator, Alternative splicing, Cytoplasm, DNA-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation |
| Sequence MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREAAANTNRPSPG GHERKLVTKLQNSERKKRGARR |
| UniProt accession: O60356 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for using the rabbit anti-p8 (CT) polyclonal antibody in Western blotting?
For immunoblotting applications, the rabbit anti-p8 (CT) polyclonal antibody is recommended to be used at a dilution range of 1:500 to 1:1,000.
How should the rabbit anti-p8 (CT) polyclonal antibody be stored to maintain its stability?
This antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-p8 (CT) polyclonal antibody?
The immunogen for this antibody is a peptide corresponding to the C-terminus of the human p8 protein.
Which secondary antibodies are compatible with the rabbit anti-p8 (CT) polyclonal antibody for detection?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific antibodies conjugated to peroxidase, biotin, or FITC. Cross-absorbed versions of these conjugates are also compatible for enhanced specificity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.