| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | p70S6K Kinase |
| available sizes | 100 µg |
rabbit anti-p70S6K Kinase polyclonal antibody 8413
$522.00
Antibody summary
- Rabbit polyclonal to p70S6K Kinase
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-p70S6K Kinase polyclonal antibody 8413
| target relevance |
|---|
| Homo sapiens RPS6KB1 Ribosomal protein S6 kinase beta-1 |
| Protein names Ribosomal protein S6 kinase beta-1 |
| Alternative names 70 kDa ribosomal protein S6 kinase 1, Ribosomal protein S6 kinase I, Serine/threonine-protein kinase 14A, p70 ribosomal S6 kinase alpha |
| Gene names RPS6KB1 |
| Protein family Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily |
| Function Serine/threonine-protein kinase that acts downstream of mTOR signaling in response to growth factors and nutrients to promote cell proliferation, cell growth and cell cycle progression (PubMed:11500364, PubMed:12801526, PubMed:14673156, PubMed:15071500, PubMed:15341740, PubMed:16286006, PubMed:17052453, PubMed:17053147, PubMed:17936702, PubMed:18952604, PubMed:19085255, PubMed:19720745, PubMed:19935711, PubMed:19995915, PubMed:22017876, PubMed:23429703, PubMed:28178239). Regulates protein synthesis through phosphorylation of EIF4B, RPS6 and EEF2K, and contributes to cell survival by repressing the pro-apoptotic function of BAD (PubMed:11500364, PubMed:12801526, PubMed:14673156, PubMed:15071500, PubMed:15341740, PubMed:16286006, PubMed:17052453, PubMed:17053147, PubMed:17936702, PubMed:18952604, PubMed:19085255, PubMed:19720745, PubMed:19935711, PubMed:19995915, PubMed:22017876, PubMed:23429703, PubMed:28178239). Under conditions of nutrient depletion, the inactive form associates with the EIF3 translation initiation complex (PubMed:16286006). Upon mitogenic stimulation, phosphorylation by the mechanistic target of rapamycin complex 1 (mTORC1) leads to dissociation from the EIF3 complex and activation (PubMed:16286006). The active form then phosphorylates and activates several substrates in the pre-initiation complex, including the EIF2B complex and the cap-binding complex component EIF4B (PubMed:16286006). Also controls translation initiation by phosphorylating a negative regulator of EIF4A, PDCD4, targeting it for ubiquitination and subsequent proteolysis (PubMed:17053147). Promotes initiation of the pioneer round of protein synthesis by phosphorylating POLDIP3/SKAR (PubMed:15341740). In response to IGF1, activates translation elongation by phosphorylating EEF2 kinase (EEF2K), which leads to its inhibition and thus activation of EEF2 (PubMed:11500364). Also plays a role in feedback regulation of mTORC2 by mTORC1 by phosphorylating MAPKAP1/SIN1, MTOR and RICTOR, resulting in the inhibition of mTORC2 and AKT1 signaling (PubMed:15899889, PubMed:19720745, PubMed:19935711, PubMed:19995915). Also involved in feedback regulation of mTORC1 and mTORC2 by phosphorylating DEPTOR (PubMed:22017876). Mediates cell survival by phosphorylating the pro-apoptotic protein BAD and suppressing its pro-apoptotic function (By similarity). Phosphorylates mitochondrial URI1 leading to dissociation of a URI1-PPP1CC complex (PubMed:17936702). The free mitochondrial PPP1CC can then dephosphorylate RPS6KB1 at Thr-412, which is proposed to be a negative feedback mechanism for the RPS6KB1 anti-apoptotic function (PubMed:17936702). Mediates TNF-induced insulin resistance by phosphorylating IRS1 at multiple serine residues, resulting in accelerated degradation of IRS1 (PubMed:18952604). In cells lacking functional TSC1-2 complex, constitutively phosphorylates and inhibits GSK3B (PubMed:17052453). May be involved in cytoskeletal rearrangement through binding to neurabin (By similarity). Phosphorylates and activates the pyrimidine biosynthesis enzyme CAD, downstream of MTOR (PubMed:23429703). Following activation by mTORC1, phosphorylates EPRS and thereby plays a key role in fatty acid uptake by adipocytes and also most probably in interferon-gamma-induced translation inhibition (PubMed:28178239) |
| Catalytic activity L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+) L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+) |
| Subcellular location Cytoplasm |
| Structure (Microbial infection) Interacts with Mumps virus phosphoprotein; this interaction may play a role in the viral replication and transcription |
| Post-translational modification Phosphorylation at Thr-412 is regulated by mTORC1. The phosphorylation at this site is maintained by an agonist-dependent autophosphorylation mechanism (PubMed:18925875, PubMed:19085255, PubMed:22017876, PubMed:23429703, PubMed:29236692). Activated by phosphorylation at Thr-252 by PDPK1 (PubMed:19864428, PubMed:9445476). Dephosphorylation by PPP1CC at Thr-412 in mitochondrion (PubMed:17936702) |
| Keywords 3D-structure, Acetylation, Alternative initiation, Alternative splicing, Apoptosis, ATP-binding, Cell cycle, Cytoplasm, Kinase, Membrane, Mitochondrion, Mitochondrion outer membrane, Nucleotide-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Synapse, Synaptosome, Transferase, Translation regulation |
| Sequence MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL |
| UniProt accession: P23443 |
Data
 |
| Detection of human and mouse p70S6K by western blot. Samples: Whole cell lysate (50 µg ) from HeLa and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-p70S6K antibody 8413 (lot 8413-2) used for WB at 0.05 µg /ml. Detection: Chemiluminescence with an exposure time of 3 minutes. |
FAQ & Publications
Frequently Asked Questions
What are the recommended applications and dilution ranges for the rabbit anti-p70S6K Kinase polyclonal antibody (SKU 8413)?
This antibody is suitable for Western Blot (WB) and Immunocytochemistry/Immunofluorescence (ICC/IF) applications. For Western Blot, the recommended dilution range is 0.05 to 0.4 µg/mL.
How should the rabbit anti-p70S6K Kinase polyclonal antibody be stored to maintain its stability?
The antibody should be stored in liquid form at 2 to 8°C. Under these conditions, it remains stable for up to one year. The storage buffer is a Tris-citrate/phosphate buffer at pH 7 to 8.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.