| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | NPFF2 |
| available sizes | 100 µg |
rabbit anti-NPFF2 polyclonal antibody 4785
$376.00
Antibody summary
- Rabbit polyclonal to NPFF2
- Suitable for: WB,ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-NPFF2 polyclonal antibody 4785
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution ELISA: use at 1:1,000-1:5,000 dilution. |
| Immunogen N-terminal sequence MNEKWDTNSSENWHPI and C-terminal sequence ELVMEELKETTNSSEI of human NPFF2. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens NPFFR2 Neuropeptide FF receptor 2 |
| Protein names Neuropeptide FF receptor 2 |
| Alternative names G-protein coupled receptor 74, G-protein coupled receptor HLWAR77, Neuropeptide G-protein coupled receptor |
| Gene names NPFFR2 |
| Protein family Belongs to the G-protein coupled receptor 1 family |
| Function Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide like ligands. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system |
| Subcellular location Cell membrane |
| Keywords 3D-structure, Alternative splicing, Cell membrane, Disulfide bond, G-protein coupled receptor, Glycoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Transducer, Transmembrane, Transmembrane helix |
| Sequence MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI |
| UniProt accession: Q9Y5X5 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-NPFF2 polyclonal antibody 4785 validated for, and what are the recommended dilutions?
This antibody is validated for Western blotting (WB) and ELISA applications. For immunoblotting, the recommended dilution is 1:500 to 1:1,000, and for ELISA, the recommended dilution ranges from 1:1,000 to 1:5,000.
How should the rabbit anti-NPFF2 polyclonal antibody 4785 be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.