| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | NPFF1 |
| available sizes | 100 µg |
rabbit anti-NPFF1 polyclonal antibody 3683
$376.00
Antibody summary
- Rabbit polyclonal to NPFF1
- Suitable for: WB,ELISA
- Isotype: Whole IgG
- 100 µg
rabbit anti-NPFF1 polyclonal antibody 3683
| antibody |
|---|
| Tested applications WB,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution ELISA: use at 1:1,000-1:5,000 dilution. |
| Immunogen N-terminal sequence MEGEPSQPPNSSWPLS and C-terminal sequence CSHLPLTIPAWDI of human NPFF1. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4 |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens NPFFR1 Neuropeptide FF receptor 1 |
| Protein names Neuropeptide FF receptor 1 |
| Alternative names G-protein coupled receptor 147, RFamide-related peptide receptor OT7T022 |
| Gene names NPFFR1 |
| Protein family Belongs to the G-protein coupled receptor 1 family |
| Function Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide like ligands. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system |
| Subcellular location Cell membrane |
| Keywords 3D-structure, Cell membrane, Disulfide bond, G-protein coupled receptor, Glycoprotein, Membrane, Receptor, Reference proteome, Transducer, Transmembrane, Transmembrane helix |
| Sequence MEGEPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALIFLLCMVG NTLVCFIVLKNRHMHTVTNMFILNLAVSDLLVGIFCMPTTLVDNLITGWPFDNATCKMSG LVQGMSVSASVFTLVAIAVERFRCIVHPFREKLTLRKALVTIAVIWALALLIMCPSAVTL TVTREEHHFMVDARNRSYPLYSCWEAWPEKGMRRVYTTVLFSHIYLAPLALIVVMYARIA RKLCQAPGPAPGGEEAADPRASRRRARVVHMLVMVALFFTLSWLPLWALLLLIDYGQLSA PQLHLVTVYAFPFAHWLAFFNSSANPIIYGYFNENFRRGFQAAFRARLCPRPSGSHKEAY SERPGGLLHRRVFVVVRPSDSGLPSESGPSSGAPRPGRLPLRNGRVAHHGLPREGPGCSH LPLTIPAWDI |
| UniProt accession: Q9GZQ6 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-NPFF1 polyclonal antibody 3683 suitable for?
This antibody has been tested and is suitable for use in Western blotting (WB) and ELISA assays.
What is the recommended dilution range for using this antibody in immunoblotting?
For immunoblotting applications, the recommended dilution is between 1:500 and 1:1,000.
How should the rabbit anti-NPFF1 antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. Avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the host species and clonality of the anti-NPFF1 antibody 3683?
This antibody is a rabbit polyclonal antibody of the IgG isotype.
What sequences were used as immunogens to generate this NPFF1 antibody?
The antibody was raised against the N-terminal sequence MEGEPSQPPNSSWPLS and the C-terminal sequence CSHLPLTIPAWDI of human NPFF1.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.