| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | NKIAMRE |
| available sizes | 100 µg |
rabbit anti-NKIAMRE polyclonal antibody 8759
$376.00
Antibody summary
- Rabbit polyclonal to NKIAMRE
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-NKIAMRE polyclonal antibody 8759
| target relevance |
|---|
| Homo sapiens CDKL3 Cyclin-dependent kinase-like 3 |
| Protein names Cyclin-dependent kinase-like 3 |
| Alternative names Serine/threonine-protein kinase NKIAMRE |
| Gene names CDKL3 |
| Protein family Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily |
| Catalytic activity L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+) L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+) |
| Subcellular location Cytoplasm |
| Keywords 3D-structure, Alternative splicing, ATP-binding, Cytoplasm, Kinase, Nucleotide-binding, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transferase |
| Sequence MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHE NLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNN IIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGK PVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLP QVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFIEKFMPELK AKLLQEAKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKEKKPKEIKVRV IKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCNGLKE NPHCGGSVTMPPINLTNSNLMAANLSSNLFHPSVRLTERAKKRRTSSQSIGQVMPNSRQE DPGPIQSQMEKGIFNERTGHSDQMANENKRKLNFSRSDRKEFHFPELPVTIQSKDTKGME VKQIKMLKRESKKTESSKIPTLLNVDQNQEKQEGGDGHCEGKNLKRNRFFFW |
| UniProt accession: Q8IVW4 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution for using the rabbit anti-NKIAMRE polyclonal antibody in Western blot applications?
The recommended dilution for immunoblotting (Western blot) with this antibody is between 1:500 and 1:1,000.
Which species does this anti-NKIAMRE antibody target, and what is the immunogen used for its production?
This antibody targets the human NKIAMRE protein and was generated using a peptide corresponding to amino acids 414-428 of the human NKIAMRE protein as the immunogen.
How should this rabbit anti-NKIAMRE polyclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions; multiple freeze-thaw cycles should be avoided to preserve antibody integrity.
Is this anti-NKIAMRE antibody compatible with secondary antibodies for detection, and if so, which types are recommended?
Yes, this antibody is compatible with several goat anti-rabbit IgG secondary antibodies, including peroxidase conjugated, biotin conjugated, FITC conjugated, and cross-absorbed polyclonal antibodies specific to the heavy and light chains.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.