| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Neurturin |
| available sizes | 100 µg |
rabbit anti-Neurturin polyclonal antibody 6199
$445.00
Antibody summary
- Rabbit polyclonal to Neurturin
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-Neurturin polyclonal antibody 6199
| target relevance |
|---|
| Homo sapiens NRTN Neurturin |
| Protein names Neurturin |
| Gene names NRTN |
| Protein family Belongs to the TGF-beta family. GDNF subfamily |
| Function Growth factor that supports the survival of sympathetic neurons in culture (PubMed:8945474). May regulate the development and maintenance of the CNS (PubMed:8945474). Involved in the development of the neural crest (PubMed:15242795). Might control the size of non-neuronal cell population such as haemopoietic cells (PubMed:8945474). Acts by binding to its coreceptor, GFRA2, leading to autophosphorylation and activation of the RET receptor (PubMed:10829012, PubMed:29414779, PubMed:31535977). Heparan sulfate-binding is required for signaling (PubMed:29414779) |
| Subcellular location Secreted |
| Structure Homodimer; disulfide-linked (PubMed:29414779, PubMed:31535977). Interacts with GFRA2 coreceptor and RET: forms a 2:2:2 ternary complex composed of NRTN ligand, GFRA2 and RET receptor (PubMed:31535977). Also forms a 4:4:4 tetrameric complex composed of 4 copies of NRTN ligand, GFRA2 and RET receptor, which prevents endocytosis of RET (PubMed:31535977) |
| Keywords 3D-structure, Disease variant, Disulfide bond, Growth factor, Hirschsprung disease, Reference proteome, Secreted, Signal |
| Sequence MQRWKAAALASVLCSSVLSIWMCREGLLLSHRLGPALVPLHRLPRTLDARIARLAQYRAL LQGAPDAMELRELTPWAGRPPGPRRRAGPRRRRARARLGARPCGLRELEVRVSELGLGYA SDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAH SRYHTVHELSARECACV |
| UniProt accession: Q99748 |
Data
 |
| Western blot analysis of NTN in HeLa cell lyaste containing 10 or 2.5 ng of full length recombinant NTN with neurturin antibody at 1:500. |
 |
| Immunohistochemistry of neurturin in human brain tissue with neurturin antibody at 5 µg/mL. |
 |
| Immunofluorescence of Neurturin in human brain tissue with Neurturin antibody at 5 µg/mL.
Green: Neuriturin Antibody (6199) Red: Phylloidin staining Blue: DAPI staining |
 |
| Immunohistochemistry of Neurturin in human brain tissue with Neurturin antibody at 5 µg/mL. |
 |
| Immunohistochemistry of Neurturin in mouse brain tissue with Neurturin Antibody at 5 µg/mL. |
 |
| Immunofluorescence of Neurturin in mouse brain tissue with Neurturin Antibody at 20 µg/mL.
Green: Neuriturin Antibody (6199) Red: Phylloidin staining Blue: DAPI staining |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-Neurturin polyclonal antibody 6199 been validated for?
This antibody has been tested and validated for use in Western blotting (WB), immunohistochemistry (IHC), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA.
How should the rabbit anti-Neurturin polyclonal antibody 6199 be stored to ensure stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to maintain antibody integrity.
What is the immunogen used to generate the rabbit anti-Neurturin polyclonal antibody 6199?
The antibody was raised against a peptide corresponding to amino acids 178-193 of human Neurturin.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.