Immunohistochemistry (IHC) : Human rhabdomyosarcoma stained with anti-MyoD1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of sarcoma cells.

rabbit anti-MyoD1 monoclonal antibody (ZR262) 6277

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to MyoD1
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Rhabdomyosarcoma
Visualization: Nuclear and cytoplasmic
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6277parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, monoclonal, MyoD1, Soft Tissue Pathology

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-MyoD1 monoclonal antibody ZR262 6277

antibody
Database link: human P15172
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: Rhabdomyosarcoma
Immunogen Synthetic peptide corresponding to residues within aa 1-100 of human MyoD1
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens MYOD1 Myoblast determination protein 1
Protein names Myoblast determination protein 1
Alternative names Class C basic helix-loop-helix protein 1, Myogenic factor 3
Gene names MYOD1
Function Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Together with MYF5 and MYOG, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Interacts with and is inhibited by the twist protein. This interaction probably involves the basic domains of both proteins (By similarity)
Subcellular location Nucleus
Structure Efficient DNA binding requires dimerization with another bHLH protein. Seems to form active heterodimers with ITF-2. Interacts with SUV39H1. Interacts with DDX5. Interacts with CHD2. Interacts with TSC22D3 (By similarity). Interacts with SETD3 (By similarity). Interacts with P-TEFB complex; promotes the transcriptional activity of MYOD1 through its CDK9-mediated phosphorylation (By similarity) (PubMed:12037670). Interacts with CSRP3. Interacts with NUPR1 (By similarity)
Post-translational modification Phosphorylated by CDK9. This phosphorylation promotes its function in muscle differentiation Acetylated by a complex containing EP300 and PCAF. The acetylation is essential to activate target genes. Conversely, its deacetylation by SIRT1 inhibits its function (By similarity) Ubiquitinated on the N-terminus; which is required for proteasomal degradation Methylation at Lys-104 by EHMT2/G9a inhibits myogenic activity
Involvement in disease Congenital myopathy 17 An autosomal recessive muscular disorder characterized by hypotonia and respiratory insufficiency apparent soon after birth, high diaphragmatic dome on imaging, poor overall growth, pectus excavatum, dysmorphic facies, and renal anomalies in some affected individuals. Additional variable features include delayed motor development, mildly decreased endurance, distal arthrogryposis, and lung hypoplasia resulting in early death.
Keywords Acetylation, Activator, Developmental protein, Differentiation, Disease variant, DNA-binding, Methylation, Myogenesis, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation
Sequence MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS PDAAPQCPAGANPNPIYQVL
UniProt accession: P15172

Data

Human rhabdomyosarcoma stained with anti-MyoD1 antibody using peroxidase-conjugate and DAB chromogen. Note the nuclear staining of sarcoma cells.

FAQ & Publications

Frequently Asked Questions

What applications is the rabbit anti-MyoD1 monoclonal antibody (ZR262) suitable for?

This antibody is validated for use in immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissue samples.

How should the rabbit anti-MyoD1 monoclonal antibody be stored to maintain stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term preservation, store at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

What species does the rabbit anti-MyoD1 monoclonal antibody specifically react with?

This monoclonal antibody is reactive with human MyoD1 protein.

What is the recommended dilution for using the concentrated form of the rabbit anti-MyoD1 antibody in IHC?

The concentrated antibody should be diluted between 1:100 and 1:200 for optimal immunohistochemical staining.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.