| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | MyoD (Phospho-Ser200) |
| available sizes | 100 µL |
rabbit anti-MyoD (Phospho-Ser200) polyclonal antibody 6932
$366.00
Antibody summary
- Rabbit polyclonal to MyoD (Phospho-Ser200)
- Suitable for: WB
- Isotype: Whole IgG
- 100 µl
rabbit anti-MyoD (Phospho-Ser200) polyclonal antibody 6932
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~40kDa is detected. These are recommended working dilutions. End users should determine optimal dilutions for their applications. |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 200 (A-S-S(p)-P-R) derived from human MyoD and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens MYOD1 Myoblast determination protein 1 |
| Protein names Myoblast determination protein 1 |
| Alternative names Class C basic helix-loop-helix protein 1, Myogenic factor 3 |
| Gene names MYOD1 |
| Function Acts as a transcriptional activator that promotes transcription of muscle-specific target genes and plays a role in muscle differentiation. Together with MYF5 and MYOG, co-occupies muscle-specific gene promoter core region during myogenesis. Induces fibroblasts to differentiate into myoblasts. Interacts with and is inhibited by the twist protein. This interaction probably involves the basic domains of both proteins (By similarity) |
| Subcellular location Nucleus |
| Structure Efficient DNA binding requires dimerization with another bHLH protein. Seems to form active heterodimers with ITF-2. Interacts with SUV39H1. Interacts with DDX5. Interacts with CHD2. Interacts with TSC22D3 (By similarity). Interacts with SETD3 (By similarity). Interacts with P-TEFB complex; promotes the transcriptional activity of MYOD1 through its CDK9-mediated phosphorylation (By similarity) (PubMed:12037670). Interacts with CSRP3. Interacts with NUPR1 (By similarity) |
| Post-translational modification Phosphorylated by CDK9. This phosphorylation promotes its function in muscle differentiation Acetylated by a complex containing EP300 and PCAF. The acetylation is essential to activate target genes. Conversely, its deacetylation by SIRT1 inhibits its function (By similarity) Ubiquitinated on the N-terminus; which is required for proteasomal degradation Methylation at Lys-104 by EHMT2/G9a inhibits myogenic activity |
| Involvement in disease Congenital myopathy 17 An autosomal recessive muscular disorder characterized by hypotonia and respiratory insufficiency apparent soon after birth, high diaphragmatic dome on imaging, poor overall growth, pectus excavatum, dysmorphic facies, and renal anomalies in some affected individuals. Additional variable features include delayed motor development, mildly decreased endurance, distal arthrogryposis, and lung hypoplasia resulting in early death. |
| Keywords Acetylation, Activator, Developmental protein, Differentiation, Disease variant, DNA-binding, Methylation, Myogenesis, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation |
| Sequence MELLSPPLRDVDLTAPDGSLCSFATTDDFYDDPCFDSPDLRFFEDLDPRLMHVGALLKPE EHSHFPAAVHPAPGAREDEHVRAPSGHHQAGRCLLWACKACKRKTTNADRRKAATMRERR RLSKVNEAFETLKRCTSSNPNQRLPKVEILRNAIRYIEGLQALLRDQDAAPPGAAAAFYA PGPLPPGRGGEHYSGDSDASSPRSNCSDGMMDYSGPPSGARRRNCYEGAYYNEAPSEPRP GKSAAVSSLDCLSSIVERISTESPAAPALLLADVPSESPPRRQEAAAPSEGESSGDPTQS PDAAPQCPAGANPNPIYQVL |
| UniProt accession: P15172 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for using the rabbit anti-MyoD (Phospho-Ser200) polyclonal antibody in Western blot applications?
For Western blotting, it is recommended to use the antibody at a dilution of 1:500 to 1:1,000. Users should optimize the dilution based on their specific experimental conditions.
How should the rabbit anti-MyoD (Phospho-Ser200) polyclonal antibody be stored to maintain its stability?
This antibody should be stored at -20°C, where it remains stable for at least one year. It is supplied in a PBS buffer without magnesium and calcium ions, at pH 7.4 with 150 mM NaCl.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.