| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Smac (mouse CT) |
| available sizes | 100 µg |
rabbit anti-mSmac (CT) polyclonal antibody 8528
$445.00
Antibody summary
- Rabbit polyclonal to mSmac (CT)
- Suitable for: ELISA,WB,IHC-P,IF,IP
- Isotype: IgG
- 100 µg
rabbit anti-mSmac (CT) polyclonal antibody 8528
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Positive control: Mouse heart tissue lysate. Immunohistochemistry: use at 2ug/mL. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Synthetic peptide corresponding to aa 222-237 of mouse Smac (accession no. AF203914). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus DIABLO Diablo IAP-binding mitochondrial protein |
| Protein names Diablo IAP-binding mitochondrial protein |
| Alternative names Diablo homolog, mitochondrial, Direct IAP-binding protein with low pI, Second mitochondria-derived activator of caspase |
| Gene names Diablo |
| Protein family Belongs to the Smac/DIABLO protein family |
| Function Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/BRUCE by inhibiting its binding to caspases (By similarity) |
| Subcellular location Mitochondrion, Cytoplasm, cytosol |
| Structure Homodimer (By similarity). Interacts with BIRC2/c-IAP1 (By similarity). Interacts with BIRC6/BRUCE (By similarity). Interacts with BIRC7/livin (By similarity). Interacts with the monomeric and dimeric form of BIRC5/survivin (By similarity). Interacts with XIAP/BIRC4 (via BIR3 domain) (By similarity). Interacts with BEX3 (PubMed:15178455). Interacts with AREL1 (via HECT domain); in the cytoplasm following induction of apoptosis (PubMed:23479728) |
| Post-translational modification Ubiquitinated by BIRC7/livin. Ubiquitinated by BIRC6 The precursor form is proteolytically cleaved by mitochondrial processing peptidase MPP to remove the transit peptide and produce an intermediate form. This is then processed by PARL to produce the mature cleaved form which is released from mitochondria into the cytosol in apoptotic cells |
| Keywords Apoptosis, Cytoplasm, Mitochondrion, Phosphoprotein, Reference proteome, Transit peptide, Ubl conjugation |
| Sequence MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQK SEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLG KMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASIT ARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED |
| UniProt accession: Q9JIQ3 |
Data
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-mSmac (CT) polyclonal antibody suitable for?
This antibody is suitable for ELISA, Western Blot (WB), Immunohistochemistry (IHC-P), Immunofluorescence (IF), and Immunoprecipitation (IP) applications.
How should the rabbit anti-mSmac (CT) antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What species does the rabbit anti-mSmac (CT) polyclonal antibody react with?
This antibody is reactive to mouse Smac (CT) protein and has been validated in mouse and rat tissues and cell lines.
What is the recommended dilution for using this antibody in immunohistochemistry?
For immunohistochemistry, it is recommended to use the antibody at a concentration of 2 µg/mL, though end users should optimize the concentration for their specific applications.
What is the immunogen used to generate this rabbit polyclonal antibody?
The antibody was raised against a synthetic peptide corresponding to amino acids 222-237 of mouse Smac (accession no. AF203914).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.

























Reviews
There are no reviews yet.