Skip to content

rabbit anti-mSmac (CT) polyclonal antibody 8528

$445.00

Antibody summary

  • Rabbit polyclonal to mSmac (CT)
  • Suitable for: ELISA,WB,IHC-P,IF,IP
  • Isotype: IgG
  • 100 µg
SKU: 8528parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

Smac (mouse CT)

available sizes

100 µg

rabbit anti-mSmac (CT) polyclonal antibody 8528

antibody
Tested applications
WB,IHC,IHC,ICC/IF,ELISA
Recommended dilutions
Immunoblotting: use at 1ug/mL.

Positive control: Mouse heart tissue lysate.

Immunohistochemistry: use at 2ug/mL.

These are recommended concentrations.

Enduser should determine optimal concentrations for their applications.
Immunogen
Synthetic peptide corresponding to aa 222-237 of mouse Smac (accession no. AF203914).
Size and concentration
100µg and lot specific
Form
liquid
Storage Instructions
This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
peptide affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Mus musculus DIABLO
Diablo IAP-binding mitochondrial protein
Protein names
Diablo IAP-binding mitochondrial protein
Alternative names
Diablo homolog, mitochondrial, Direct IAP-binding protein with low pI, Second mitochondria-derived activator of caspase
Gene names
Diablo
Protein family
Belongs to the Smac/DIABLO protein family
Function
Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/BRUCE by inhibiting its binding to caspases (By similarity)
Subcellular location
Mitochondrion, Cytoplasm, cytosol
Structure
Homodimer (By similarity). Interacts with BIRC2/c-IAP1 (By similarity). Interacts with BIRC6/BRUCE (By similarity). Interacts with BIRC7/livin (By similarity). Interacts with the monomeric and dimeric form of BIRC5/survivin (By similarity). Interacts with XIAP/BIRC4 (via BIR3 domain) (By similarity). Interacts with BEX3 (PubMed:15178455). Interacts with AREL1 (via HECT domain); in the cytoplasm following induction of apoptosis (PubMed:23479728)
Post-translational modification
Ubiquitinated by BIRC7/livin. Ubiquitinated by BIRC6
The precursor form is proteolytically cleaved by mitochondrial processing peptidase MPP to remove the transit peptide and produce an intermediate form. This is then processed by PARL to produce the mature cleaved form which is released from mitochondria into the cytosol in apoptotic cells
Keywords
Apoptosis, Cytoplasm, Mitochondrion, Phosphoprotein, Reference proteome, Transit peptide, Ubl conjugation
Sequence
MAALRSWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQK SEPQSLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLG KMNSQEEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASIT ARNHIQLVKSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED
UniProt accession: Q9JIQ3

Data

benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_1.jpg
Western Blot Validation in (A and B) Mouse Heart Tissue Lysate and (C) Rat Heart Tissue Lysate
Loading: 15 µg of lysates per lane. Antibodies: Smac 8528 (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.A Mouse heartB Mouse heart and blocking peptideC Rat heart
benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_2.gif
Independent Antibody Validation (IAV) via Protein Expression Profile in Cell Lines
Loading: 15 µg of lysates per lane. Antibodies: Smac 1409 (1 µg/mL), Smac 8528 (1 µg/mL), and beta-actin (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_3.gif
Western Blot Validation in Human, Mouse and Rat Cell Lines
Loading: 15 µg of lysates per lane. Antibodies: Smac 8528 (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_4.jpg
Immunofluorescence Validation of Smac in Mouse Spleen Cells
Immunofluorescent analysis of 4% paraformaldehyde-fixed Mouse Spleen Cells labeling Smac with 8528 at 10 µg/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (red).
benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_5.jpg
Immunohistochemistry Validation of Smac in Mouse Spleen Tissue
Immunohistochemical analysis of paraffin-embedded Mouse Spleen Tissue using anti-Smac antibody (8528) at 2 µg/mL. Tissue was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.
benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_6.gif
KO Validation in Mouse Fibroblasts and Myoblasts (Ho et al., 2416)
The indicated MEFs or MEMs were exposed to 2 uM STS for 4 h and analyzed by Western blot. Accumulation of Smac/Diablo in mitochondrion-depleted cytosol fractions fromSTS-treated Apaf-1 KO cells were detected by anti-smac antibodies. Smac expression was not detected in smac KO mice.
benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_7.gif
Immunohistochemistry Validation of Smac in Human gastric carcinoma (Kim et al., 2011)
Smac was highly expressed in gastric mucosa of patients with gastric carcinoma.
benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_8.gif
Immunofluorescence Analysis of Smac in NB4-LR1 Cells (Saumet et al., 2005)
NB4-LR1 cells were either treated with ATRA(1 uM) for 3 days without or with the T3C1 recombinant fragment (3 uM) or treated with staurosporine (STP; 5 uM ) for 3.5 hours. STP, but not ATRA or AYRA/T3C1 induced the release of smac.
benchmark-antibodies_anti-smac_mouse_ct_antibody_8528_9.gif
Induced Expression Validation in Rat Liver (Genestier et al., 2005)
Mitochondria from rat liver were treated with increasing concentrations of rPVL (A), rLukS (B), or Bax alpha (C) for 1 hour at 30 C. rPVL induces the release of the apoptogenic proteins cytochrome c and Smac/DIABLO from isolated mitochondria.

FAQ & Publications

Frequently Asked Questions
What applications is the rabbit anti-mSmac (CT) polyclonal antibody suitable for?
This antibody is suitable for ELISA, Western Blot (WB), Immunohistochemistry (IHC-P), Immunofluorescence (IF), and Immunoprecipitation (IP) applications.
How should the rabbit anti-mSmac (CT) antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What species does the rabbit anti-mSmac (CT) polyclonal antibody react with?
This antibody is reactive to mouse Smac (CT) protein and has been validated in mouse and rat tissues and cell lines.
What is the recommended dilution for using this antibody in immunohistochemistry?
For immunohistochemistry, it is recommended to use the antibody at a concentration of 2 µg/mL, though end users should optimize the concentration for their specific applications.
What is the immunogen used to generate this rabbit polyclonal antibody?
The antibody was raised against a synthetic peptide corresponding to amino acids 222-237 of mouse Smac (accession no. AF203914).
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.