| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | mRELM β |
| available sizes | 100 µg |
rabbit anti-mRELM beta polyclonal antibody 1542
$376.00
Antibody summary
- Rabbit polyclonal to mRELM beta
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-mRELM beta polyclonal antibody 1542
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. In immunoblots, a band of approximately 10 kD is detected. |
| Immunogen Synthetic peptide corresponding to aa 32-46 of mouse RELMb protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C to -70°C. Store antibody in appropriate aliquots to avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus RETNLB Resistin-like beta |
| Protein names Resistin-like beta |
| Alternative names Cysteine-rich secreted protein A12-beta, Cysteine-rich secreted protein FIZZ2, RELMbeta |
| Gene names Retnlb |
| Protein family Belongs to the resistin/FIZZ family |
| Function Probable hormone |
| Subcellular location Secreted |
| Structure Homodimer; disulfide-linked (PubMed:11358969, PubMed:15155948, PubMed:15834545). Heterodimer with RETNLG (PubMed:15834545) |
| Keywords 3D-structure, Disulfide bond, Hormone, Reference proteome, Secreted, Signal |
| Sequence MKPTLCFLFILVSLFPLIVPGNAQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLAS CPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA |
| UniProt accession: Q99P86 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-mRELM beta polyclonal antibody 1542 been validated for?
This antibody is validated for use in Western Blot (WB) and Immunocytochemistry/Immunofluorescence (ICC/IF) applications.
How should the rabbit anti-mRELM beta antibody be stored to maintain stability?
The antibody should be stored at temperatures between -20°C and -70°C and aliquoted appropriately to avoid multiple freeze-thaw cycles. Under these conditions, it remains stable for at least one year.
What is the immunogen used to generate the rabbit anti-mRELM beta polyclonal antibody 1542?
The immunogen is a synthetic peptide corresponding to amino acids 32 to 46 of the mouse RELMb protein.
Which secondary antibodies are compatible with this rabbit anti-mRELM beta polyclonal antibody for detection?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific antibodies conjugated to peroxidase, biotin, or FITC, including cross-absorbed versions for enhanced specificity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.