| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | mRELMα |
| available sizes | 100 µg |
rabbit anti-mRELM α polyclonal antibody 4974
$376.00
Antibody summary
- Rabbit polyclonal to mRELM α
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-mRELM α polyclonal antibody 4974
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. Monomeric mRELMa is approximately 11kD, dimeric mRELMa is approximately 22kD, and trimeric mRELMa is approximately 33 kD. |
| Immunogen Synthetic peptide corresponding to aa 31-44 of mouse RELMa protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C to -70°C. Store antibody in appropriate aliquots to avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus RETNLA Resistin-like alpha |
| Protein names Resistin-like alpha |
| Alternative names Cysteine-rich secreted protein A12-gamma, Cysteine-rich secreted protein FIZZ1, Hypoxia-induced mitogenic factor, Parasite-induced macrophage novel gene 1 protein, RELMalpha |
| Gene names Retnla |
| Protein family Belongs to the resistin/FIZZ family |
| Function Probable hormone. Plays a role in pulmonary vascular remodeling |
| Subcellular location Secreted |
| Structure Monomer |
| Keywords Disulfide bond, Hormone, Reference proteome, Secreted, Signal |
| Sequence MKTTTCSLLICISLLQLMVPVNTDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKT MNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS |
| UniProt accession: Q9EP95 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for using this rabbit anti-mRELM α polyclonal antibody in Western blotting?
For immunoblotting, it is recommended to use the antibody at a dilution between 1:500 and 1:1,000.
Which species does this polyclonal antibody specifically target and recognize?
This antibody specifically reacts with mouse Resistin-like alpha (mRELMα) protein.
How should the rabbit anti-mRELM α polyclonal antibody be stored to maintain stability?
The antibody should be stored at temperatures between -20°C and -70°C, preferably in aliquots to prevent multiple freeze-thaw cycles, and it remains stable for at least one year under these conditions.
What is the source and clonality of this anti-mRELM α antibody?
This product is a rabbit-derived polyclonal antibody of the IgG isotype, affinity purified using its synthetic peptide immunogen.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.