| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | mFLIP (CT) |
| available sizes | 100 µg |
rabbit anti-mFLIP (CT) polyclonal antibody 8477
$445.00
Antibody summary
- Rabbit polyclonal to mFLIP (CT)
- Suitable for: ELISA,WB,ICC
- Isotype: IgG
- 100 µg
rabbit anti-mFLIP (CT) polyclonal antibody 8477
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting : use at 2ug/mL. Immunocytochemistry: use at 5ug/mL. Positive control: Whole cell lysate from NIH/3T3 cells. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 449-465 at the C-terminus of mouse FLIPL/CASH form (accession no. NP_997536). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens CFLAR CASP8 and FADD-like apoptosis regulator |
| Protein names CASP8 and FADD-like apoptosis regulator |
| Alternative names Caspase homolog, Caspase-eight-related protein, Caspase-like apoptosis regulatory protein, Cellular FLICE-like inhibitory protein, FADD-like antiapoptotic molecule 1, Inhibitor of FLICE, MACH-related inducer of toxicity, Usurpin |
| Gene names CFLAR |
| Protein family Belongs to the peptidase C14A family |
| Function Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells (PubMed:31046799). Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity |
| Structure (Microbial infection) Interacts with HBV protein X |
| Post-translational modification Proteolytically processed by CASP8 generating subunit p43 and p12 Deubiquitinated by USP40, leading to stabilization |
| Keywords 3D-structure, Alternative splicing, Apoptosis, Host-virus interaction, Proteomics identification, Reference proteome, Repeat |
| Sequence MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
| UniProt accession: O15519 |
Data
![]() |
| Western blot analysis of FLIP in K562 cell lysate with FLIP antibody at (A) 1 and (B) 2 µg/mL. |
![]() |
| Immunocytochemistry of FLIP in 3T3 cells with FLIP antibody at 5 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-mFLIP (CT) polyclonal antibody 8477 been validated for?
This antibody is validated for use in ELISA, Western blot (WB), and immunocytochemistry/immunofluorescence (ICC/IF) applications.
What are the recommended working concentrations for this antibody in Western blot and immunocytochemistry?
For Western blotting, a concentration of 2 µg/mL is recommended, while for immunocytochemistry, a concentration of 5 µg/mL is advised. Users should optimize concentrations for their specific applications.
How should the rabbit anti-mFLIP (CT) polyclonal antibody 8477 be stored to ensure stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to maintain antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.











Reviews
There are no reviews yet.