Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human Langerhans cell histiocytosis stained with anti-langerin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor cells

rabbit anti-Langerin monoclonal antibody (ZR170) 6240

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Langerin
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: skin/Langerhans cell histiocytosis
Visualization: cell surface/cytoplasm.
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6240parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Dermatopathology, Langerin

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Langerin monoclonal antibody ZR170 6240

antibody
Database link: human Q9UJ71
Tested applications IHC
Recommended dilutions Concentrated 1:100-200
Application Notes Positive control: skin/Langerhans cell histiocytosis
Immunogen Recombinant fragment (around aa50-250) of human Langerin protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens CD207 C-type lectin domain family 4 member K
Protein names C-type lectin domain family 4 member K
Alternative names Langerin
Gene names CD207
Function Calcium-dependent lectin displaying mannose-binding specificity. Induces the formation of Birbeck granules (BGs); is a potent regulator of membrane superimposition and zippering. Binds to sulfated as well as mannosylated glycans, keratan sulfate (KS) and beta-glucans. Facilitates uptake of antigens and is involved in the routing and/or processing of antigen for presentation to T cells. Major receptor on primary Langerhans cells for Candida species, Saccharomyces species, and Malassezia furfur. Protects against human immunodeficiency virus-1 (HIV-1) infection. Binds to high-mannose structures present on the envelope glycoprotein which is followed by subsequent targeting of the virus to the Birbeck granules leading to its rapid degradation
Subcellular location Membrane
Structure Homotrimer
Involvement in disease Birbeck granule deficiency A condition characterized by the absence of Birbeck granules in epidermal Langerhans cells. Despite the lack of Birbeck granules, Langerhans cells are present in normal numbers and have normal morphologic characteristics and antigen-presenting capacity.
Keywords 3D-structure, Coiled coil, Disulfide bond, Glycoprotein, Lectin, Membrane, Proteomics identification, Reference proteome, Signal-anchor, Transmembrane, Transmembrane helix
Sequence MTVEKEAPDAHFTVDKQNISLWPREPPPKSGPSLVPGKTPTVRAALICLTLVLVASVLLQ AVLYPRFMGTISDVKTNVQLLKGRVDNISTLDSEIKKNSDGMEAAGVQIQMVNESLGYVR SQFLKLKTSVEKANAQIQILTRSWEEVSTLNAQIPELKSDLEKASALNTKIRALQGSLEN MSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQE FLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKA PSLQAWNDAPCDKTFLFICKRPYVPSEP
UniProt accession: Q9UJ71

Data

Formalin-fixed, paraffin-embedded human Langerhans cell histiocytosis stained with anti-langerin antibody using peroxidase-conjugate and DAB chromogen. Note cytoplasmic staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What species does the rabbit anti-Langerin monoclonal antibody (ZR170) specifically react with?

This antibody is reactive with human species and is suitable for immunohistochemistry applications on formalin-fixed, paraffin-embedded human tissues.

What are the recommended storage conditions for the rabbit anti-Langerin monoclonal antibody (ZR170)?

For short-term storage, keep the antibody at 2-8°C. For long-term preservation, store it at -20°C and avoid repeated freeze/thaw cycles to maintain antibody integrity.

Can you provide details on the immunogen used to generate the rabbit anti-Langerin monoclonal antibody (ZR170)?

The immunogen is a recombinant fragment of the human Langerin protein, approximately spanning amino acids 50 to 250.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.