Immunohistochemistry (IHC) : Formalin-fixed, paraffin-embedded human squamous cell carcinoma stained with anti-desmoglein-3 monoclonal antibody using peroxidase-conjugate and DAB chromogen. Note membranous staining of tumor cells

rabbit anti-Desmoglein-3 monoclonal antibody (ZR128) 6159

Price range: $160.00 through $528.00

Antibody summary

Rabbit monoclonal to Desmoglein-3
Suitable for: Immunohistochemistry (formalin-fixed, paraffin-embedded tissues)
Reacts with: Human
Isotype:IgG
Control: Squamous cell carcinoma
Visualization: Membrane
0.1, 0.5, 1.0 mL concentrated, 7 mL prediluted

available sizes

Clear

SKU: 6159parent Categories: antibody, Zeta IHC antibodies Tags: anatomy, Dermatopathology, Desmoglein-3

Weight	1 lbs
Dimensions	9 × 5 × 2 in
host	mouse
isotype	IgG
clonality	monoclonal
concentration	concentrate, predilute
applications	IHC
reactivity	human
available size	0.1 mL, 0.5 mL, 1 mL concentrated, 7 mL prediluted

rabbit anti-Desmoglein-3 monoclonal antibody ZR128 6159

antibody
Database link: human Q14574
Tested applications IHC
Recommended dilutions Concentrated 1:100
Application Notes Positive control: Squamous cell carcinoma
Immunogen Recombinant fragment (around aa 379-491) human DSG3 protein
Size and concentration 7 mL prediluted or 0.1, 0.5, 1.0 mL and concentrated
Form liquid
Storage Instructions 2-8°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.
Purity affinity purified
Clonality monoclonal
Isotype IgG
Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control Rabbit polyclonal - Isotype Control

target relevance
Homo sapiens DSC3 Desmocollin-3
Protein names Desmocollin-3
Alternative names Cadherin family member 3, Desmocollin-4, HT-CP
Gene names DSC3
Function A component of desmosome cell-cell junctions which are required for positive regulation of cellular adhesion (By similarity). Required for cell-cell adhesion in the epidermis, as a result required for the maintenance of the dermal cohesion and the dermal barrier function (PubMed:19717567). Required for cell-cell adhesion of epithelial cell layers surrounding the telogen hair club, as a result plays an important role in telogen hair shaft anchorage (By similarity). Essential for successful completion of embryo compaction and embryo development (By similarity)
Subcellular location Cell membrane, Cell junction, desmosome, Cytoplasm
Structure May form homodimers (PubMed:19717567). Interacts with DSG1; there is evidence to suggest that the interaction promotes cell-cell adhesion of keratinocytes (PubMed:19717567)
Involvement in disease Hypotrichosis and recurrent skin vesicles A disorder characterized by hypotrichosis and the appearance of recurrent skin vesicle formation. Affected individuals show sparse and fragile hair on scalp, as well as absent eyebrows and eyelashes. Vesicles filled with thin, watery fluid are observed on the scalp and skin of most of the body. Mucosal vesicles are absent.
Keywords Alternative splicing, Calcium, Cell adhesion, Cell junction, Cell membrane, Cleavage on pair of basic residues, Cytoplasm, Direct protein sequencing, Glycoprotein, Hypotrichosis, Membrane, Metal-binding, Proteomics identification, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix
Sequence MAAAGPRRSVRGAVCLHLLLTLVIFSRAGEACKKVILNVPSKLEADKIIGRVNLEECFRS ADLIRSSDPDFRVLNDGSVYTARAVALSDKKRSFTIWLSDKRKQTQKEVTVLLEHQKKVS KTRHTRETVLRRAKRRWAPIPCSMQENSLGPFPLFLQQVESDAAQNYTVFYSISGRGVDK EPLNLFYIERDTGNLFCTRPVDREEYDVFDLIAYASTADGYSADLPLPLPIRVEDENDNH PVFTEAIYNFEVLESSRPGTTVGVVCATDRDEPDTMHTRLKYSILQQTPRSPGLFSVHPS TGVITTVSHYLDREVVDKYSLIMKVQDMDGQFFGLIGTSTCIITVTDSNDNAPTFRQNAY EAFVEENAFNVEILRIPIEDKDLINTANWRVNFTILKGNENGHFKISTDKETNEGVLSVV KPLNYEENRQVNLEIGVNNEAPFARDIPRVTALNRALVTVHVRDLDEGPECTPAAQYVRI KENLAVGSKINGYKAYDPENRNGNGLRYKKLHDPKGWITIDEISGSIITSKILDREVETP KNELYNITVLAIDKDDRSCTGTLAVNIEDVNDNPPEILQEYVVICKPKMGYTDILAVDPD EPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAA TKLLRVNLCECTHPTQCRATSRSTGVILGKWAILAILLGIALLFSVLLTLVCGVFGATKG KRFPEDLAQQNLIISNTEAPGDDRVCSANGFMTQTTNNSSQGFCGTMGSGMKNGGQETIE MMKGGNQTLESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKLHRCNQNE DRMPSQDYVLTYNYEGRGSPAGSVGCCSEKQEEDGLDFLNNLEPKFITLAEACTKR
UniProt accession: Q14574

Data

Formalin-fixed, paraffin-embedded human squamous cell carcinoma stained with anti-desmoglein-3 monoclonal antibody using peroxidase-conjugate and DAB chromogen. Note membranous staining of tumor cells

FAQ & Publications

Frequently Asked Questions

What is the recommended application for the rabbit anti-Desmoglein-3 monoclonal antibody (ZR128)?

This antibody is suitable for Immunohistochemistry (IHC) on formalin-fixed, paraffin-embedded human tissues.

How should the rabbit anti-Desmoglein-3 antibody be stored to maintain its stability?

For short-term storage, keep the antibody at 2-8°C. For longer-term storage, it should be stored at -20°C. Avoid repeated freeze/thaw cycles to preserve antibody integrity.

Which species is this anti-Desmoglein-3 monoclonal antibody reactive with?

The antibody specifically reacts with human Desmoglein-3 protein.

What is the host species and clonality of the anti-Desmoglein-3 antibody ZR128?

This antibody is a rabbit monoclonal antibody of the IgG isotype.

What immunogen was used to generate the rabbit anti-Desmoglein-3 monoclonal antibody?

The immunogen was a recombinant fragment of the human DSG3 protein, approximately amino acids 379 to 491.

Publications

pmid	title	authors	citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.