| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | KLK9 |
| available sizes | 100 µg |
rabbit anti-KLK9 polyclonal antibody 4566
$376.00
Antibody summary
- Rabbit polyclonal to KLK9
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-KLK9 polyclonal antibody 4566
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. A band of approximately 28 kD is detected. |
| Immunogen Peptide corresponding to aa 239-250 of human KLK9 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens KLK9 Kallikrein-9 |
| Protein names Kallikrein-9 |
| Alternative names Kallikrein-like protein 3 |
| Gene names KLK9 |
| Protein family Belongs to the peptidase S1 family. Kallikrein subfamily |
| Subcellular location Secreted |
| Keywords Alternative splicing, Disulfide bond, Glycoprotein, Hydrolase, Protease, Proteomics identification, Reference proteome, Secreted, Serine protease, Signal |
| Sequence MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLT AAHCRKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQ ARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYP GHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHY LDWIQEIMEN |
| UniProt accession: Q9UKQ9 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for using the rabbit anti-KLK9 polyclonal antibody in Western blot applications?
For immunoblotting (Western blot), it is recommended to use the rabbit anti-KLK9 polyclonal antibody at a dilution between 1:500 and 1:1,000. At this dilution, a protein band of approximately 28 kDa corresponding to KLK9 can be detected.
How should the rabbit anti-KLK9 polyclonal antibody be stored to maintain its stability?
The antibody should be stored at -70°C to ensure stability for at least one year. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What immunogen was used to generate the rabbit anti-KLK9 polyclonal antibody and what is its specificity?
The antibody was raised against a peptide corresponding to amino acids 239-250 of the human KLK9 protein. It specifically recognizes the KLK9 protein, which is part of the kallikrein subfamily of serine proteases.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.








Reviews
There are no reviews yet.