| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | KLK3 |
| available sizes | 100 µg |
rabbit anti-KLK3 polyclonal antibody 9136
$9,999.00
Antibody summary
- Rabbit polyclonal to KLK3
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-KLK3 polyclonal antibody 9136
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. A band of approximately 30 kD is detected. |
| Immunogen Peptide corresponding to aa 247-261 of human KLK3 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens KLK3 Prostate-specific antigen |
| Protein names Prostate-specific antigen |
| Alternative names Gamma-seminoprotein, Kallikrein-3, P-30 antigen, Semenogelase |
| Gene names KLK3 |
| Protein family Belongs to the peptidase S1 family. Kallikrein subfamily |
| Function Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum |
| Catalytic activity Preferential cleavage: -Tyr-|-Xaa-. |
| Subcellular location Secreted |
| Structure Forms a heterodimer with SERPINA5 |
| Keywords 3D-structure, Alternative splicing, Direct protein sequencing, Disulfide bond, Glycoprotein, Hydrolase, Protease, Proteomics identification, Reference proteome, Secreted, Serine protease, Signal, Zymogen |
| Sequence MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP SLYTKVVHYRKWIKDTIVANP |
| UniProt accession: P07288 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-KLK3 polyclonal antibody 9136 been validated for, and what are the recommended dilution ranges?
This rabbit anti-KLK3 polyclonal antibody 9136 has been tested and recommended for Western blot (WB) applications. The suggested dilution range for immunoblotting is 1:500 to 1:1,000, where a band of approximately 30 kDa is typically detected.
How should the rabbit anti-KLK3 polyclonal antibody 9136 be stored to maintain its stability?
The antibody should be stored at -70°C to ensure stability for at least one year. It is important to avoid multiple freeze-thaw cycles to maintain antibody integrity. The antibody is supplied in PBS buffer at pH 7.4.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.