| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | KLK15 |
| available sizes | 100 µg |
rabbit anti-KLK15 polyclonal antibody 7412
$9,999.00
Antibody summary
- Rabbit polyclonal to KLK15
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-KLK15 polyclonal antibody 7412
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. A band of approximately 28 kD is detected. |
| Immunogen Peptide corresponding to aa 75-87 of human KLK15 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens KLK15 Kallikrein-15 |
| Protein names Kallikrein-15 |
| Alternative names ACO protease |
| Gene names KLK15 |
| Protein family Belongs to the peptidase S1 family. Kallikrein subfamily |
| Function Protease whose physiological substrate is not yet known |
| Subcellular location Secreted |
| Keywords Alternative splicing, Disulfide bond, Glycoprotein, Hydrolase, Protease, Proteomics identification, Reference proteome, Secreted, Serine protease, Signal, Zymogen |
| Sequence MWLLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSA AHCQSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNP QVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSC DKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYT KVCHYLEWIRETMKRN |
| UniProt accession: Q9H2R5 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-KLK15 polyclonal antibody 7412 validated for, and what is the recommended dilution for immunoblotting?
The rabbit anti-KLK15 polyclonal antibody 7412 is tested and suitable for Western blot (WB) applications. For immunoblotting, it is recommended to use the antibody at a dilution range of 1:500 to 1:1,000, where it detects a band of approximately 28 kDa.
How should the rabbit anti-KLK15 polyclonal antibody 7412 be stored to maintain its stability?
This antibody should be stored at -70°C to ensure stability for at least one year. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.