| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | KLK14 |
| available sizes | 100 µg |
rabbit anti-KLK14 polyclonal antibody 6787
$376.00
Antibody summary
- Rabbit polyclonal to KLK14
- Suitable for: WB
- Isotype: Whole IgG
- 100 µg
rabbit anti-KLK14 polyclonal antibody 6787
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. A band of approximately 31 kD is detected. |
| Immunogen Peptide corresponding to aa 239-251 of human KLK14 protein. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -70°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity immunogen affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens KLK14 Kallikrein-14 |
| Protein names Kallikrein-14 |
| Alternative names Kallikrein-like protein 6 |
| Gene names KLK14 |
| Protein family Belongs to the peptidase S1 family. Kallikrein subfamily |
| Function Serine-type endopeptidase with a dual trypsin-like and chymotrypsin-like substrate specificity. May activate/inactivate the proteinase-activated receptors F2R, F2RL1 and F2RL3 and other kallikreins including KLK1, KLK3, KLK5 and KLK11. May function in seminal clot liquefaction through direct cleavage of the semenogelin SEMG1 and SEMG2 and activation of KLK3. May function through desmoglein DSG1 cleavage in epidermal desquamation a process by which the most superficial corneocytes are shed from the skin surface. May be involved in several aspects of tumor progression including growth, invasion and angiogenesis |
| Subcellular location Secreted, extracellular space |
| Post-translational modification Proteolytic cleavage of the activation peptide produces the active enzyme |
| Keywords Autocatalytic cleavage, Direct protein sequencing, Disulfide bond, Hydrolase, Protease, Proteomics identification, Reference proteome, Secreted, Serine protease, Signal, Zymogen |
| Sequence MFLLLTALQVLAIAMTQSQEDENKIIGGHTCTRSSQPWQAALLAGPRRRFLCGGALLSGQ WVITAAHCGRPILQVALGKHNLRRWEATQQVLRVVRQVTHPNYNSRTHDNDLMLLQLQQP ARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIARYPASLQCVNINISPDEVCQKAYP RTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWGMERCALPGYPGVYTNLCKY RSWIEETMRDK |
| UniProt accession: Q9P0G3 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution range for using the rabbit anti-KLK14 polyclonal antibody in Western blotting?
For immunoblotting (Western blot), the rabbit anti-KLK14 polyclonal antibody should be used at a dilution between 1:500 and 1:1,000. At this dilution, a band of approximately 31 kDa is detected.
How should the rabbit anti-KLK14 polyclonal antibody be stored to maintain its stability?
The antibody is supplied in PBS buffer at pH 7.4 and should be stored at -70°C. It remains stable for at least one year under these conditions. To preserve antibody integrity, avoid multiple freeze-thaw cycles.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.