| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | JunD (Phospho-Ser255) |
| available sizes | 100 µL |
rabbit anti-JunD (Phospho-Ser255) polyclonal antibody 1360
$366.00
Antibody summary
- Rabbit polyclonal to JunD (Phospho-Ser255)
- Suitable for: WB,IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-JunD (Phospho-Ser255) polyclonal antibody 1360
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~38kDa is detected. Immunohistochemistry: use at dilution of 1:50- 1:100. These are recommended working dilutions. End user should determine optimal dilutions for their applications. |
| Immunogen Peptide sequence that includes phosphorylation site of serine 255 (G-E-S(p)-P-P) derived from human JunD and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens JUND Transcription factor JunD |
| Protein names Transcription factor JunD |
| Alternative names Transcription factor AP-1 subunit JunD |
| Gene names JUND |
| Protein family Belongs to the bZIP family. Jun subfamily |
| Function Transcription factor binding AP-1 sites (PubMed:9989505). Heterodimerizes with proteins of the FOS family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to an AP-1 consensus sequence 3'-TGA[GC]TCA-5' and enhancing their transcriptional activity (PubMed:28981703, PubMed:9989505) |
| Subcellular location Nucleus |
| Structure Heterodimer; binds DNA as a heterodimer (PubMed:28981703). Component of an AP-1 transcription factor complex composed of JUN-FOS heterodimers (By similarity). As part of the AP-1 transcription factor complex, forms heterodimers with FOS proteins, thereby binding to the AP-1 consensus sequence and stimulating transcription (By similarity). Forms heterodimers with FOSB; thereby binding to the AP-1 consensus sequence (PubMed:28981703). Interacts (via MBM motif) with MEN1; this interaction represses transcriptional activation (PubMed:22327296, PubMed:9989505). Interacts with MAPK10; this interaction is inhibited in the presence of MEN1 (PubMed:22327296) |
| Post-translational modification Phosphorylated by MAP kinases MAPK8 and MAPK10; phosphorylation is inhibited in the presence of MEN1 |
| Keywords 3D-structure, Activator, Disulfide bond, DNA-binding, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation |
| Sequence METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY |
| UniProt accession: P17535 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-JunD (Phospho-Ser255) polyclonal antibody suitable for?
This antibody is validated for use in Western blotting (WB) and immunohistochemistry (IHC) applications.
How should the rabbit anti-JunD (Phospho-Ser255) antibody be stored to maintain stability?
The antibody should be stored at -20°C, where it remains stable for at least one year.
What is the recommended dilution range for this antibody in immunoblotting experiments?
For immunoblotting, use the antibody at a dilution of 1:500 to 1:1,000, where it detects a band of approximately 38 kDa.
What is the host species and clonality of this anti-JunD (Phospho-Ser255) antibody?
The antibody is a rabbit polyclonal IgG.
What is the immunogen used to generate this rabbit anti-JunD (Phospho-Ser255) antibody?
The immunogen is a peptide sequence containing the phosphorylation site at serine 255 (G-E-S(p)-P-P) derived from human JunD and conjugated to KLH.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.