| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | JunB (Phospho-Ser259) |
| available sizes | 100 µL |
rabbit anti-JunB (Phospho-Ser259) polyclonal antibody 3670
$366.00
Antibody summary
- Rabbit polyclonal to JunB (Phospho-Ser259)
- Suitable for: WB,IHC
- Isotype: Whole IgG
- 100 µl
rabbit anti-JunB (Phospho-Ser259) polyclonal antibody 3670
| antibody |
|---|
| Tested applications WB,IHC,IHC |
| Recommended dilutions Immunoblotting: use at dilution of 1:500-1:1,000. A band of ~43kDa is detected. Immunohistochemistry: use at dilution of 1:50- 1:100. These are recommended working dilutions. End user should determine optimal dilutions for their applications. |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 259 (P-B-S(p)-P-I) derived from human JunB and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens JUNB Transcription factor JunB |
| Protein names Transcription factor JunB |
| Alternative names Transcription factor AP-1 subunit JunB |
| Gene names JUNB |
| Protein family Belongs to the bZIP family. Jun subfamily |
| Function Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[GC]TCA-3'. Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA binding activity to an AP-1 consensus sequence and its transcriptional activity (By similarity) |
| Subcellular location Nucleus |
| Structure Binds DNA as a homodimer or as a heterodimer with another member of the Jun/Fos family. Component of an AP-1 transcription factor complex composed of JUN-FOS heterodimers composed of JUN-FOS heterodimers (By similarity). As part of the AP-1 transcription factor complex, forms heterodimers with FOSB, thereby binding to the AP-1 consensus sequence and stimulating transcription (By similarity). Interacts with ITCH (via its WW domains) |
| Post-translational modification Ubiquitinated by ITCH, leading to its degradation |
| Keywords Acetylation, DNA-binding, Isopeptide bond, Nucleus, Phosphoprotein, Proteomics identification, Reference proteome, Transcription, Transcription regulation, Ubl conjugation |
| Sequence MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF |
| UniProt accession: P17275 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-JunB (Phospho-Ser259) polyclonal antibody been validated for?
This antibody is suitable for use in Western blot (WB) and immunohistochemistry (IHC) applications.
What is the recommended dilution range for using this antibody in immunoblotting?
For immunoblotting, it is recommended to use this antibody at a dilution of 1:500 to 1:1,000, where it detects a band of approximately 43 kDa.
How should the rabbit anti-JunB (Phospho-Ser259) antibody be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions.
What is the immunogen used to generate this rabbit polyclonal antibody?
The immunogen is a peptide sequence containing the phosphorylation site at serine 259 (P-B-S(p)-P-I) derived from human JunB and conjugated to KLH.
Which secondary antibodies are compatible with this rabbit anti-JunB (Phospho-Ser259) polyclonal antibody?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific, conjugated with peroxidase, biotin, or FITC, available as both regular and cross-absorbed polyclonal antibodies.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.