| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | IRAK2 |
| available sizes | 100 µg |
rabbit anti-IRAK2 polyclonal antibody 8028
$445.00
Antibody summary
- Rabbit polyclonal to IRAK2
- Suitable for: ELISA,WB,ICC,IF
- Isotype: IgG
- 100 µg
rabbit anti-IRAK2 polyclonal antibody 8028
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1:500-1:1,000 dilution. Positive control: Whole cell lysate from HeLa cells or K562 cells. No cross- reactivity with IRAK. |
| Immunogen Peptide corresponding to aa 546- 564 of human IRAK2. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens IRAK2 Interleukin-1 receptor-associated kinase-like 2 |
| Protein names Interleukin-1 receptor-associated kinase-like 2 |
| Gene names IRAK2 |
| Protein family Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily |
| Function Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization |
| Structure Interacts with MYD88. IL-1 stimulation leads to the formation of a signaling complex which dissociates from the IL-1 receptor following the binding of PELI1 |
| Keywords 3D-structure, ATP-binding, Nucleotide-binding, Phosphoprotein, Proteomics identification, Reference proteome |
| Sequence MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWKPAPEIRCPIPAFPDSVKPEKPLAASV RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEKGAGRLPEDCAEALATAACL CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE AKRKLMENILLYKEEKVDSIELFGP |
| UniProt accession: O43187 |
Data
 |
| Western blot analysis of IRAK2 in HeLa (H) and K562 (K) whole cell lysate with IRAK2 antibody (C2) at 2 µg/mL. |
 |
| Immunocytochemical staining of HeLa cells using IRAK2 antibody at 2 µg/mL. |
 |
| Immunofluorescence of IRAK-2 in Hela cells with IRAK-2 antibody at 10 µg/mL. |
 |
| Immunofluorescence of IRAK-M in human spleen tissue with IRAK M antibody at 20 µg/mL.
Green: IRAK-2 Antibody (8028) Blue: DAPI staining |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-IRAK2 polyclonal antibody 8028 validated for?
This antibody is validated for use in Western blotting (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA applications.
How should the rabbit anti-IRAK2 antibody 8028 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-IRAK2 polyclonal antibody 8028?
The immunogen is a peptide corresponding to amino acids 546-564 of the human IRAK2 protein.
Which secondary antibodies are compatible with the rabbit anti-IRAK2 polyclonal antibody 8028 for detection?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific antibodies conjugated to peroxidase, biotin, or FITC, including cross-absorbed variants for enhanced specificity.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.