Skip to content

rabbit anti-IRAK-4 polyclonal antibody 8508

$445.00

Antibody summary

  • Rabbit polyclonal to IRAK-4
  • Suitable for: ELISA,WB,ICC,IF
  • Isotype: IgG
  • 100 µg
SKU: 8508parent Category: Tag:
Weight 1 lbs
Dimensions 9 × 5 × 2 in
host

rabbit

isotype

IgG

clonality

polyclonal

concentration

1 mg/mL

applications

ICC/IF, WB

reactivity

IRAK-4

available sizes

100 µg

rabbit anti-IRAK-4 polyclonal antibody 8508

antibody
Tested applications
WB,ICC/IF,ELISA
Recommended dilutions
Immunoblotting: Use at 1-4ug/mL. A band of approximately 50kDa is detected.

Immunocytochemistry: Use at 10ug/mL.

Immunofluorescence: Use at 10ug/mL.

These are recommended concentrations.

Enduser should determine optimal concentrations for their applications.
Immunogen
A synthetic peptide corresponding to amino acids at the carboxy terminus of human IRAK-4.
Size and concentration
100µg and 1 mg/mL
Form
liquid
Storage Instructions
Stable for one year at -20°C. Store in appropriate aliquots to avoid multiple freeze-thaw cycles.
Storage buffer
PBS, pH 7.4.
Purity
peptide affinity purification
Clonality
polyclonal
Isotype
IgG
Compatible secondaries
goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863
goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371
goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715
goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720
Isotype control
Rabbit polyclonal - Isotype Control
target relevance
Homo sapiens IRAK4
Interleukin-1 receptor-associated kinase 4
Protein names
Interleukin-1 receptor-associated kinase 4
Alternative names
Renal carcinoma antigen NY-REN-64
Gene names
IRAK4
Protein family
Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. Pelle subfamily
Function
Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways (PubMed:17878374). Is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation to form the Myddosome together with IRAK2. Phosphorylates initially IRAK1, thus stimulating the kinase activity and intensive autophosphorylation of IRAK1. Phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2 and PELI3) to promote pellino-mediated polyubiquitination of IRAK1. Then, the ubiquitin-binding domain of IKBKG/NEMO binds to polyubiquitinated IRAK1 bringing together the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. In turn, MAP3K7/TAK1 activates IKKs (CHUK/IKKA and IKBKB/IKKB) leading to NF-kappa-B nuclear translocation and activation. Alternatively, phosphorylates TIRAP to promote its ubiquitination and subsequent degradation. Phosphorylates NCF1 and regulates NADPH oxidase activation after LPS stimulation suggesting a similar mechanism during microbial infections
Catalytic activity
L-seryl-[protein] + ATP = O-phospho-L-seryl-[protein] + ADP + H(+)
L-threonyl-[protein] + ATP = O-phospho-L-threonyl-[protein] + ADP + H(+)
Subcellular location
Cytoplasm
Structure
Associates with MYD88 and IRAK2 to form a ternary complex called the Myddosome (PubMed:16951688, PubMed:24316379). Once phosphorylated, IRAK4 dissociates from the receptor complex and then associates with the TNF receptor-associated factor 6 (TRAF6), IRAK1, and PELI1; this intermediate complex is required for subsequent NF-kappa-B activation (PubMed:11960013, PubMed:12496252, PubMed:16951688). Direct binding of SMAD6 to PELI1 prevents complex formation and hence negatively regulates IL1R-TLR signaling and eventually NF-kappa-B-mediated gene expression (PubMed:16951688). Interacts with IL1RL1 (PubMed:16286016). Interacts (when phosphorylated) with IRAK1 (PubMed:33238146). May interact (when phosphorylated) with IRAK3 (PubMed:33238146)
Post-translational modification
Phosphorylated
Involvement in disease
Immunodeficiency 67
An autosomal recessive primary immunodeficiency characterized by recurrent, life-threatening systemic and invasive bacterial infections beginning in infancy or early childhood.

Keywords
3D-structure, Acetylation, Alternative splicing, ATP-binding, Cytoplasm, Disease variant, Immunity, Innate immunity, Kinase, Magnesium, Nucleotide-binding, Phosphoprotein, Proteomics identification, Reference proteome, Serine/threonine-protein kinase, Transferase
Sequence
MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL QTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITV QQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNF DERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKC QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGIN FLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL RGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS
UniProt accession: Q9NWZ3

Data

benchmark-antibodies_anti-irak-4_antibody_8508_1.gif
Western Blot Validation in Human Cell Lines
Loading: 15 ug/ of lysates per lane. Antibodies: IRAK4 8508 (1 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-irak-4_antibody_8508_2.gif
Independent Antibody Validation (IAV) via Protein Expression Profile in Cell Lines
Loading: 15 µg of lysates per lane. Antibodies: IRAK4-8508 (1 µg/mL), IRAK4-24-025 (1 µg/mL), beta-actin (1.5 µg/mL), 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.
benchmark-antibodies_anti-irak-4_antibody_8508_3.jpg
Western Blot Validation in Human HeLa Cell Lines
Loading: 15 µg of lysates per lane. Antibodies: IRAK4 8508, 1h incubation at RT in 5% NFDM/TBST.Secondary: Goat anti-rabbit IgG HRP conjugate at 1:10000 dilution.Lane 1: 1 µg/mLLane 2: 2 µg/mLLane 3: 4 µg/mL
benchmark-antibodies_anti-irak-4_antibody_8508_4.jpg
Immunocytochemistry Validation of IRAK4 in K562 Cells
Immunocytochemical analysis of K562 cells using anti-IRAK4 antibody (8508) at 10 µg/mL. Cells was fixed with formaldehyde and blocked with 10% serum for 1 h at RT; antigen retrieval was by heat mediation with a citrate buffer (pH6). Samples were incubated with primary antibody overnight at 4 C. A goat anti-rabbit IgG H&L (HRP) at 1/250 was used as secondary. Counter stained with Hematoxylin.
benchmark-antibodies_anti-irak-4_antibody_8508_5.jpg
Immunofluorescence Validation of IRAK4 in K562 Cells
Immunofluorescent analysis of 4% paraformaldehyde-fixed K562 Cells labeling IRAK4 with 8508 at 10 µg/mL, followed by goat anti-rabbit IgG secondary antibody at 1/500 dilution (red).
benchmark-antibodies_anti-irak-4_antibody_8508_6.gif
KO and KD Validation of IRAK4 in Mouse Bone Marrow-derived Macrophages (BMDM) (Koziczak-Holbro et al., 2008)
Western blot analysis with anti-IRAK4 antibodies was performed for IRAK4 in BMDM isolated from the mice. IRAK4 expression was not observed in the IRAK-4-/- cells and also reduced in IRAK4 mutant (IRAK-4 KD) when compared with WT.
benchmark-antibodies_anti-irak-4_antibody_8508_7.gif
Regulated Expression Validation of IRAK4 in Mouse RAW 264 Cells (Hatao et al., 2004)
RAW 264 cells were stimulated with (a) CSK4 and (b) CpG-DNA in the absence or presence of proteasome inhibitors (MG132 and Lactactstin). When detected with anti-IRAK4 antibodies (C12 from , Inc.), IRAK4 expression was found to be reduced without the inhibitors. The smaller protein band, a cleavage product of IRAK4, was present in the absence of both inhibitors.
benchmark-antibodies_anti-irak-4_antibody_8508_8.gif
KD Validation of IRAK4 in HEK293T Cells (Heinz et al., 2012)
Western blot analysis with anti-IRAK4 antibodies was performed for IRAK4 in HEK293T cells. IRAK4 expression was not observed in IRAK4 knockdown cells.

FAQ & Publications

Frequently Asked Questions
What applications is the rabbit anti-IRAK-4 polyclonal antibody 8508 validated for?
This antibody is validated for ELISA, Western Blot (WB), Immunocytochemistry (ICC), and Immunofluorescence (IF) applications.
How should the rabbit anti-IRAK-4 polyclonal antibody 8508 be stored to maintain stability?
The antibody should be stored at -20°C in appropriate aliquots to avoid multiple freeze-thaw cycles, and it remains stable for one year under these conditions.
What is the recommended concentration for using this anti-IRAK-4 antibody in Western blotting and immunofluorescence?
For Western blotting, use the antibody at 1-4 µg/mL. For immunocytochemistry and immunofluorescence, a concentration of 10 µg/mL is recommended.
What is the immunogen used to generate the rabbit anti-IRAK-4 polyclonal antibody 8508?
The immunogen is a synthetic peptide corresponding to amino acids at the carboxy terminus of human IRAK-4.
Publications
pmid title authors citation
We haven't added any publications to our database yet.

Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.

Protocols

relevant to this product
Western blot
IHC
ICC

Documents

Batch Number QC File SDS
To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In.

Reviews

There are no reviews yet.

Only logged in customers who have purchased this product may leave a review.