| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | ILP-2 |
| available sizes | 100 µg |
rabbit anti-ILP-2 polyclonal antibody 5027
$445.00
Antibody summary
- Rabbit polyclonal to ILP-2
- Suitable for: ELISA,WB,ICC,IF
- Isotype: IgG
- 100 µg
rabbit anti-ILP-2 polyclonal antibody 5027
| antibody |
|---|
| Tested applications WB,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 1ug/mL. Immunocytochemistry: use at 10ug/mL. Positive control: HepG2 or MOLT4 cell lysates. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 2-13 of human ILP-2 (accession no. NP_203127). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens BIRC8 Baculoviral IAP repeat-containing protein 8 |
| Protein names Baculoviral IAP repeat-containing protein 8 |
| Alternative names Inhibitor of apoptosis-like protein 2, Testis-specific inhibitor of apoptosis |
| Gene names BIRC8 |
| Protein family Belongs to the IAP family |
| Function Protects against apoptosis mediated by BAX |
| Subcellular location Cytoplasm |
| Structure Binds to caspase-9 |
| Keywords 3D-structure, Apoptosis, Cytoplasm, Metal-binding, Proteomics identification, Reference proteome, Zinc, Zinc-finger |
| Sequence MTGYEARLITFGTWMYSVNKEQLARAGFYAIGQEDKVQCFHCGGGLANWKPKEDPWEQHA KWYPGCKYLLEEKGHEYINNIHLTRSLEGALVQTTKKTPSLTKRISDTIFPNPMLQEAIR MGFDFKDVKKIMEERIQTSGSNYKTLEVLVADLVSAQKDTTENELNQTSLQREISPEEPL RRLQEEKLCKICMDRHIAVVFIPCGHLVTCKQCAEAVDRCPMCSAVIDFKQRVFMS |
| UniProt accession: Q96P09 |
Data
 |
| Western blot analysis of ILP-2 expression in human HepG2 (lane 1) and MOLT4 (lane 2) cell lysates with ILP-2 antibody at 1 µg/mL. |
 |
| Immunocytochemistry of ILP-2 in HepG2 cells with ILP-2 antibody at 10 µg/mL. |
 |
| Immunofluorescence of ILP-2 in HepG2 cells with ILP-2 antibody at 20 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications is the rabbit anti-ILP-2 polyclonal antibody 5027 validated for?
This antibody has been tested and validated for use in Western blot (WB), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA applications.
How should the rabbit anti-ILP-2 polyclonal antibody 5027 be stored to maintain its stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the recommended dilution for using this antibody in immunoblotting and immunocytochemistry?
For immunoblotting, a concentration of 1 µg/mL is recommended, while for immunocytochemistry a concentration of 10 µg/mL is suggested. Users should optimize concentrations for their specific applications.
What is the immunogen used to generate the rabbit anti-ILP-2 polyclonal antibody 5027?
The antibody was raised against a peptide corresponding to amino acids 2-13 of the human ILP-2 protein (accession no. NP_203127).
Which secondary antibodies are compatible with the rabbit anti-ILP-2 polyclonal antibody 5027 for detection purposes?
Compatible secondary antibodies include goat anti-rabbit IgG, H&L chain specific, conjugated with peroxidase, biotin, FITC, and cross-absorbed variants, allowing flexibility depending on the detection method.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.