| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Interleukin-22 Receptor (IL-22R) (NT) |
| available sizes | 100 µg |
rabbit anti-IL-22R (NT) polyclonal antibody 8937
$445.00
Antibody summary
- Rabbit polyclonal to IL-22R (NT)
- Suitable for: ELISA,WB,IHC-P,ICC,IF
- Isotype: Whole IgG
- 100 µg
rabbit anti-IL-22R (NT) polyclonal antibody 8937
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 0.5-1 ug/mL. In immunoblots, a band of 62 kD is detected. Positive control: HepG2 cell lysate. |
| Immunogen Peptide corresponding to aa 31-46 of human IL-22R precursor. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens IL22RA1 Interleukin-22 receptor subunit alpha-1 |
| Protein names Interleukin-22 receptor subunit alpha-1 |
| Alternative names Cytokine receptor class-II member 9, Cytokine receptor family 2 member 9, ZcytoR11 |
| Gene names IL22RA1 |
| Protein family Belongs to the type II cytokine receptor family |
| Function Component of the receptor for IL20, IL22 and IL24. Component of IL22 receptor formed by IL22RA1 and IL10RB enabling IL22 signaling via JAK/STAT pathways. IL22 also induces activation of MAPK1/MAPK3 and Akt kinases pathways. Component of one of the receptor for IL20 and IL24 formed by IL22RA1 and IL20RB also signaling through STATs activation. Mediates IL24 antiangiogenic activity as well as IL24 inhibitory effect on endothelial cell tube formation and differentiation |
| Subcellular location Cell membrane |
| Structure Heterodimer with IL10RB and with IL20RB. IL22 binding to heterodimer is greater than binding to IL22RA1 alone (PubMed:11035029, PubMed:15120653, PubMed:18675809). Interacts with FBXW12; the interaction promotes ubiquitination of IL22RA1 (PubMed:26171402) |
| Post-translational modification Ubiquitinated |
| Keywords 3D-structure, Cell membrane, Disulfide bond, Glycoprotein, Membrane, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix, Ubl conjugation |
| Sequence MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTY GERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTT LKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLG GKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMG FLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ YSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVG PPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLS SPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNV LHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPK DEAKSPAPETSDLEQPTELDSLFRGLALTVQWES |
| UniProt accession: Q8N6P7 |
Data
 |
| Western blot analysis of IL-22 receptor expression in human HepG2 cell lysate with IL-22 receptor antibody at (A) 0.5 and (B) 1 µg/mL. |
 |
| Immunohistochemistry of IL-22R in rat kidney tissue with IL-22R antibody at 5 µg/mL. |
 |
| Immunofluorescence of IL-22 receptor in HepG2 cells with IL-22 receptor antibody at 10 µg/mL. |
 |
| Immunocytochemistry of IL-22 receptor in HepG2 cells with IL-22 receptor antibody at 10 µg/mL. |
 |
| Immunofluorescence of IL-22R in rat kidney tissue with IL-22R antibody at 20 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What species is the host for the anti-IL-22R (NT) polyclonal antibody 8937?
The host species for this antibody is rabbit.
Which applications has the rabbit anti-IL-22R (NT) polyclonal antibody 8937 been validated for?
This antibody has been tested and validated for use in Western blot (WB), immunohistochemistry (IHC-P), immunocytochemistry/immunofluorescence (ICC/IF), and ELISA.
How should the rabbit anti-IL-22R (NT) polyclonal antibody 8937 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is recommended to avoid multiple freeze-thaw cycles.
What is the immunogen used to generate the rabbit anti-IL-22R (NT) polyclonal antibody 8937?
The immunogen is a peptide corresponding to amino acids 31-46 of the human IL-22R precursor protein.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.