| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | Interleukin-21 Receptor (IL-21R) (ED) |
| available sizes | 100 µg |
rabbit anti-IL-21R (ED) polyclonal antibody 6790
$445.00
Antibody summary
- Rabbit polyclonal to IL-21R (ED)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: Whole IgG
- 100 µg
rabbit anti-IL-21R (ED) polyclonal antibody 6790
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting: use at 0.5-1 ug/mL. In immunoblots, a band of 60 kD is detected. Positive control: Raji cell lysate. |
| Immunogen Peptide corresponding to aa 97-111 of human IL-21R precursor. |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze- thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens IL21R Interleukin-21 receptor |
| Protein names Interleukin-21 receptor |
| Alternative names Novel interleukin receptor |
| Gene names IL21R |
| Protein family Belongs to the type I cytokine receptor family. Type 4 subfamily |
| Function This is a receptor for interleukin-21 |
| Subcellular location Membrane |
| Structure Heterodimer with the common gamma subunit. Associates with JAK1 |
| Post-translational modification C-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame |
| Involvement in disease Immunodeficiency 56 An autosomal recessive primary immunodeficiency characterized by B- and T-cell defects and variable dysfunction of NK cells. Patients tend to have normal numbers of lymphocytes, but show defective class-switched B-cells, low IgG, defective antibody response, and defective T-cell responses to certain antigens. |
| Keywords 3D-structure, Chromosomal rearrangement, Direct protein sequencing, Disease variant, Disulfide bond, Glycoprotein, Membrane, Proteomics identification, Receptor, Reference proteome, Repeat, Signal, Transmembrane, Transmembrane helix |
| Sequence MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKP APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL LLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSS LELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGG SAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLD AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS PLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS |
| UniProt accession: Q9HBE5 |
Data
 |
| Western blot analysis of IL-21 receptor expression in human HepG2 cell lysate with IL-21 receptor antibody at (A) 1 and (B) 2 µg/mL. |
 |
| Immunohistochemistry of IL-21 receptor in rat lung with IL-21 receptor antibody at 10 µg/mL. |
 |
| Immunofluorescence of IL-21 Receptor in Rat Lung cells with IL-21 Receptor antibody at 20 µg/mL. |
 |
| Immunofluorescence of IL21R in A431 cells with IL 21 Receptor antibody at 20 µg/mL.
Green: IL-21 Receptor Antibody (6790) Blue: DAPI staining |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-IL-21R (ED) polyclonal antibody been validated for?
This antibody has been tested and is suitable for use in Western blotting (WB), immunohistochemistry (IHC-P), immunofluorescence (IF), ELISA, and immunocytochemistry (ICC/IF). Recommended dilutions for immunoblotting are 0.5-1 µg/mL.
How should the rabbit anti-IL-21R (ED) polyclonal antibody be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen used to generate the rabbit anti-IL-21R (ED) polyclonal antibody?
The immunogen is a peptide corresponding to amino acids 97-111 of the human IL-21 receptor precursor.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.