| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | ICAD (NT) |
| available sizes | 100 µg |
rabbit anti-ICAD (NT) polyclonal antibody 7891
$445.00
Antibody summary
- Rabbit polyclonal to ICAD (NT)
- Suitable for: ELISA,WB,IHC-P,IF
- Isotype: IgG
- 100 µg
rabbit anti-ICAD (NT) polyclonal antibody 7891
| antibody |
|---|
| Tested applications WB,IHC,IHC,ICC/IF,ELISA |
| Recommended dilutions Immunoblotting : use at 1ug/mL. Immunohistochemistry: use at 2ug/mL. Positive control: Mouse lung tissue lysate. These are recommended concentrations. Enduser should determine optimal concentrations for their applications. |
| Immunogen Peptide corresponding to aa 2-21 at the N-terminus of mouse ICAD (accession no. O54786). |
| Size and concentration 100µg and lot specific |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. Avoid multiple freeze-thaw cycles. |
| Storage buffer PBS, pH 7.4. |
| Purity peptide affinity purification |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Mus musculus DFFA DNA fragmentation factor subunit alpha |
| Protein names DNA fragmentation factor subunit alpha |
| Alternative names DNA fragmentation factor 45 kDa subunit, Inhibitor of CAD |
| Gene names Dffa |
| Function Inhibitor of the caspase-activated DNase (DFF40) |
| Subcellular location Cytoplasm |
| Structure Heterodimer of DFFA and DFFB |
| Post-translational modification Caspase-3 cleaves DFF45 at 2 sites to generate an active factor |
| Keywords 3D-structure, Acetylation, Alternative splicing, Apoptosis, Cytoplasm, Phosphoprotein, Reference proteome |
| Sequence MELSRGASAPDPDDVRPLKPCLLRRNHSRDQHGVAASSLEELRSKACELLAIDKSLTPIT LVLAEDGTIVDDDDYFLCLPSNTKFVALACNEKWIYNDSDGGTAWVSQESFEADEPDSRA GVKWKNVARQLKEDLSSIILLSEEDLQALIDIPCAELAQELCQSCATVQGLQSTLQQVLD QREEARQSKQLLELYLQALEKEGNILSNQKESKAALSEELDAVDTGVGREMASEVLLRSQ ILTTLKEKPAPELSLSSQDLESVSKEDPKALAVALSWDIRKAETVQQACTTELALRLQQV QSLHSLRNLSARRSPLPGEPQRPKRAKRDSS |
| UniProt accession: O54786 |
Data
 |
| Antibodies: DR4 1167 (4 µg/mL), 1h incubation at RT in 5% NFDM/TBST. |
 |
| Immunohistochemistry of ICAD in mouse lung tissue with ICAD antibody at 2 µg/mL. |
 |
| Immunofluorescence of ICAD in Mouse Lung cells with ICAD antibody at 10 µg/mL. |
FAQ & Publications
Frequently Asked Questions
What applications has the rabbit anti-ICAD (NT) polyclonal antibody 7891 been validated for?
This antibody has been tested and is suitable for ELISA, Western blot (WB), immunohistochemistry on paraffin-embedded sections (IHC-P), and immunofluorescence (IF) applications.
What is the recommended dilution for immunohistochemistry using this ICAD antibody?
For immunohistochemistry, it is recommended to use the antibody at a concentration of 2 µg/mL. However, end users should optimize this concentration for their specific experimental conditions.
How should the rabbit anti-ICAD (NT) polyclonal antibody 7891 be stored to maintain stability?
The antibody should be stored at -20°C and is stable for at least one year under these conditions. It is important to avoid multiple freeze-thaw cycles to preserve antibody integrity.
What is the immunogen for this rabbit anti-ICAD (NT) polyclonal antibody?
The immunogen is a peptide corresponding to amino acids 2-21 at the N-terminus of mouse ICAD (accession number O54786).
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.