| Weight | 1 lbs |
|---|---|
| Dimensions | 9 × 5 × 2 in |
| host | rabbit |
| isotype | IgG |
| clonality | polyclonal |
| concentration | 1 mg/mL |
| applications | ICC/IF, WB |
| reactivity | HNF4α (phospho-Ser304) |
| available sizes | 100 µL |
rabbit anti-HNF4 α (phospho-Ser304) polyclonal antibody 8472
$366.00
Antibody summary
- Rabbit polyclonal to HNF4 α (phospho-Ser304)
- Suitable for: WB
- Isotype: Whole IgG
- 100 µl
rabbit anti-HNF4 α (phospho-Ser304) polyclonal antibody 8472
| antibody |
|---|
| Tested applications WB |
| Recommended dilutions Immunoblotting: use at dilution of 1:1,000. A band of ~52kDa is detected. These are recommended working dilutions. End user should determine optimal dilutions for their applications |
| Immunogen Peptide sequence that includes phosphorylation site of Serine 304 (L-R-S(p)-Q-V) derived from human HNF4a and conjugated to KLH. |
| Size and concentration 100µL and 1 mg/mL |
| Form liquid |
| Storage Instructions This antibody is stable for at least one (1) year at -20°C. |
| Storage buffer PBS (without Mg2 and Ca2 ), pH 7.4, 150mM NaCl, |
| Purity affinity purified |
| Clonality polyclonal |
| Isotype IgG |
| Compatible secondaries goat anti-rabbit IgG, H&L chain specific, peroxidase conjugated, conjugated polyclonal antibody 9512 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody 2079 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody 7863 goat anti-rabbit IgG, H&L chain specific, Cross Absorbed polyclonal antibody 2371 goat anti-rabbit IgG, H&L chain specific, biotin conjugated polyclonal antibody, crossabsorbed 1715 goat anti-rabbit IgG, H&L chain specific, FITC conjugated polyclonal antibody, crossabsorbed 1720 |
| Isotype control Rabbit polyclonal - Isotype Control |
| target relevance |
|---|
| Homo sapiens HNF4A Hepatocyte nuclear factor 4-alpha |
| Protein names Hepatocyte nuclear factor 4-alpha |
| Alternative names Nuclear receptor subfamily 2 group A member 1, Transcription factor 14, Transcription factor HNF-4 |
| Gene names HNF4A |
| Protein family Belongs to the nuclear hormone receptor family. NR2 subfamily |
| Function Transcriptional regulator which controls the expression of hepatic genes during the transition of endodermal cells to hepatic progenitor cells, facilitating the recruitment of RNA pol II to the promoters of target genes (PubMed:30597922). Activates the transcription of CYP2C38 (By similarity). Represses the CLOCK-BMAL1 transcriptional activity and is essential for circadian rhythm maintenance and period regulation in the liver and colon cells (PubMed:30530698) |
| Subcellular location Nucleus |
| Structure Homodimerization is required for HNF4-alpha to bind to its recognition site (PubMed:14982928). Interacts with CLOCK, BMAL1, CRY1, CRY2, PER1 and PER2 (PubMed:30530698). Interacts with NR0B2/SHP; the resulting heterodimer is transcriptionally inactive (PubMed:28128295). Interacts with DDX3X; this interaction disrupts the interaction between HNF4 and NR0B2 that forms inactive heterodimers and enhances the formation of active HNF4 homodimers (PubMed:28128295) |
| Post-translational modification Phosphorylated on tyrosine residue(s); phosphorylation is important for its DNA-binding activity. Phosphorylation may directly or indirectly play a regulatory role in the subnuclear distribution. Phosphorylation at Ser-313 by AMPK reduces the ability to form homodimers and bind DNA Acetylation at Lys-458 lowers transcriptional activation by about two-fold |
| Involvement in disease Maturity-onset diabetes of the young 1 A form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. Type 2 diabetes mellitus A multifactorial disorder of glucose homeostasis caused by a lack of sensitivity to insulin. Affected individuals usually have an obese body habitus and manifestations of a metabolic syndrome characterized by diabetes, insulin resistance, hypertension and hypertriglyceridemia. The disease results in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Fanconi renotubular syndrome 4 with maturity-onset diabetes of the young An autosomal dominant disease characterized by Fanconi syndrome associated with a beta cell phenotype of neonatal hyperinsulinism with macrosomia and young onset diabetes. Fanconi syndrome is a proximal tubulopathy resulting in generalized aminoaciduria, low molecular weight proteinuria, glycosuria, hyperphosphaturia and hypouricemia. Some FRTS4 patients have nephrocalcinosis, renal impairment, hypercalciuria with relative hypocalcemia, and hypermagnesemia. |
| Keywords 3D-structure, Acetylation, Activator, Alternative promoter usage, Alternative splicing, Biological rhythms, Diabetes mellitus, Disease variant, DNA-binding, Isopeptide bond, Metal-binding, Nucleus, Phosphoprotein, Proteomics identification, Receptor, Reference proteome, Repressor, Transcription, Transcription regulation, Ubl conjugation, Zinc, Zinc-finger |
| Sequence MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI |
| UniProt accession: P41235 |
Data
| No results found |
FAQ & Publications
Frequently Asked Questions
What is the recommended dilution for using the rabbit anti-HNF4 α (phospho-Ser304) polyclonal antibody in Western blot applications?
For Western blotting, it is recommended to use the rabbit anti-HNF4 α (phospho-Ser304) polyclonal antibody at a dilution of 1:1,000. At this dilution, a band of approximately 52 kDa is typically detected. Users should optimize the dilution based on their specific experimental conditions.
How should the rabbit anti-HNF4 α (phospho-Ser304) polyclonal antibody be stored to maintain its stability?
This antibody should be stored at -20°C, where it remains stable for at least one year. It is supplied in a phosphate-buffered saline (PBS) solution without magnesium and calcium ions, at pH 7.4, containing 150 mM sodium chloride.
Publications
| pmid | title | authors | citation |
|---|---|---|---|
| We haven't added any publications to our database yet. | |||
Published literature highly relevant to the biological target of this product and referencing this antibody or clone are retrieved from the PubMed database provided by the United States National Library of Medicine at the National Institutes of Health.
Protocols
| relevant to this product |
|---|
| Western blot IHC ICC |
Documents
| Batch Number | QC File | SDS |
|---|---|---|
| To view batch-specific Safety Datasheets and Quality Certificates associated with your account, please Log In. | ||
Only logged in customers who have purchased this product may leave a review.
Reviews
There are no reviews yet.